KEGG   Burkholderia gladioli BSR3: bgla_1g18070Help
Entry
bgla_1g18070      CDS       T01464                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bgla_1g18070
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    bgla_1g18070
  Amino acid metabolism
   00310 Lysine degradation
    bgla_1g18070
Enzymes [BR:bgd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     bgla_1g18070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2043151..2044434
Genome map
AA seq 427 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLSQV
LQNDGDTVVADQVIATIDTEAKAGAVAAAAGEAEVRPAPAPVAVEAAPAAQAAAASGSSN
TTASPAAAKLLAEKGVDPSQVSGTGRDGRITKGDALGANATPVKAASAPAAAAPKKAAAL
PDVKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRA
KYKDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRG
LVVPILRNADQLSLADIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPII
NPPQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDP
ARLLLDL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctttccgaatcggtttcggaagccaccatg
ctgcagtggaagaagaagcccggcgaggcggtcgcgcaggatgaaatcctgatcgaactc
gagaccgacaaggtcgtgctggaagtgccggcaccggcagccggcgtgctgtcgcaagtg
ctgcagaacgacggcgacacggtcgtcgccgaccaggtgatcgccaccatcgacaccgag
gcgaaggccggtgccgtggccgccgccgccggcgaagccgaagtgcgtccggccccggcg
ccggtcgcggtggaagccgcgccggccgcgcaagcggctgccgcctcgggctcgagcaac
accacggcctcgccggccgcagccaagctgctggccgagaagggcgtcgatccgagccag
gtctcgggcaccggccgcgacggccgcatcaccaagggcgacgcgctgggcgccaacgcc
acgccggtgaaggctgcctcggcgccggccgccgccgcgccgaagaaggccgccgcgctg
ccggacgtcaaggtgccggcctcggccaccacctggctgaacgatcgtccggaacaacgc
gtgccgatgtcgcgcctgcgcgcgcgtatcgccgagcgtctgctcgagtcgcagcagacc
aacgcgatcctgacgaccttcaacgaagtcaacatgcagccggtcatggacctgcgcgcg
aagtacaaggacaagttcgagaaggaacacggcgtgaagctcggcttcatgtccttcttc
gtcaaggcggcggtccacgcgctgaagaagttcccgctggtgaacgcgtcgatcgacggc
aacgacatcgtctatcacggctacttcgacatcggtatcgcggtcggttcgccgcgcggc
ctggtggtgccgatcctgcgcaatgccgaccagctgagcctggccgacatcgagaagaag
atcgccgaattcggtcagaaggccaaggacggcaagctgtcgatcgaggaaatgacgggc
ggtaccttctcgatctcgaacggcggcgtgttcggctcgatgctgtcgacgccgatcatc
aacccgccgcagtcggcgatcctcggcgtgcacgccaccaaggagcgcccggtggtcgag
aacggccagatcgtgattcgcccgatcaactacctcgcgctgtcgtatgaccaccggatc
atcgacggccgcgaagcggtgctttcgctggtcgccatgaaggacgcgctggaagatccg
gcgcgcctgctgctcgacctgtaa

DBGET integrated database retrieval system