KEGG   Burkholderia gladioli: bgla_1g19110Help
Entry
bgla_1g19110      CDS       T01464                                 

Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bgd  Burkholderia gladioli
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    bgla_1g19110
Enzymes [BR:bgd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     bgla_1g19110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2148076..2149017
Genome map
AA seq 313 aa AA seqDB search
MSGTPVSTSARGNVAVVGSLNMDLIVRAPRLPKPGETLSGHGYAQAAGGKGGNQAVAAAR
LGARVTMLGCVGDDANGTALRGALEAEGIDCAALATAREGVATGVALIVVDDASQNAIVI
VAGGNGEVTPAGVARHEAMIAAADVLVCQLETPLPAVKAALEAGRRHGRVVVLNPAPVLG
PLPDGWLPLVDWLIPNELEAAALTGMTIATPEDAQAAAGQLREAGARNVIVTLGAQGAFA
ALADGTARHYPAPKVEAVDTTAAGDTFIGGLSARLAAGDAPDAAIRFAQRAAALSVTRAG
AQPSIPSFAEVQG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtacgccggtttcgacctccgcgcgcggaaacgttgccgtggtcggcagcctc
aacatggacctgatcgtgcgcgcgccgcgcctgcccaagccgggcgagacgctgagcgga
cacggttacgcgcaggcggcgggcggcaagggcggcaaccaggccgtggcggccgcccgg
ctcggcgcgcgcgtgacgatgctcggctgcgtcggcgacgacgcgaacggcacggccctg
cgcggcgcgctggaggccgaggggatcgattgcgccgcgctggcgaccgcccgcgaaggc
gtggccaccggcgtggcgctgatcgtggtggacgacgcgagccagaacgcgatcgtgatc
gtggcgggcggcaacggcgaggtgacgccggccggcgtcgccaggcacgaggccatgatc
gcggccgccgacgtgctggtctgccagctcgaaacgccgctgccggccgtgaaggccgcg
ctcgaggcggggcggcgccatggccgcgtggtggtgctcaatccggcccccgtgctcggt
cccttgccggacggctggctgccgctggtcgactggctgatcccgaacgagctcgaggcc
gccgcgctgacgggcatgaccatcgcgacgcccgaggatgcgcaggcggcggcagggcaa
ctgcgggaagccggcgcgcgcaacgtgatcgtcacgctcggcgcgcaaggcgcgttcgcc
gcgctggccgacggcacggcgcgccactatccggccccgaaggtcgaggcggtcgatacc
acggccgccggcgataccttcatcggtggcttgtcggcacggctggcggcgggtgatgcg
cccgacgcggcgatccgtttcgcccagcgggccgccgccctgtcggtgacgcgcgcgggc
gcccagccctcgattccgagcttcgcggaagtgcagggctag

DBGET integrated database retrieval system