KEGG   Burkholderia gladioli: bgla_1g19270Help
Entry
bgla_1g19270      CDS       T01464                                 

Definition
Magnesium chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bgd  Burkholderia gladioli
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    bgla_1g19270
Enzymes [BR:bgd01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     bgla_1g19270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2169356..2170477
Genome map
AA seq 373 aa AA seqDB search
MNPHDPSGGLPPFPFSALIGQAALQQALLLVAIDPSIGGVLVSGPRGTAKSTAARALAEL
LPRGRFVTLPLGAADEHVTGTLDLAGALGESAVRFSPGLLARAHLGVLYVDEINLLPDGL
VDVLLDAAASGVNTVERDGISHTHAARFALVGTMNPEEGELRPQLLDRFGLMVELENCRD
IAERQRIVKARLAFDLDPAGFRAGHAGALAALAERIGRAREALAGVQVDDSVHEQVARLC
IEAAVDGLRADLVMLRAARALAAFEGAAAVSAAHVERVAADVLRHRRTQASAAAESSSPT
SSPTTSPTASRQTDQPARGANPPPRGGDASSIDRDEAPAGDGGARDGDWGYLPPVPAGLT
AVKGVIPLPSKKR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgcacgacccgagtggcggcctgccgccgtttccgttttccgcgctgatcggc
caggccgcgctgcagcaggcgctgctgctggtggccatcgatccctcgatcggcggcgtg
ctggtgagcgggccgcgcggcaccgcgaaatcgacggcggcgcgcgcgctggccgagcta
ttgccgcggggccgcttcgtgacgctgccgctgggcgccgccgacgagcacgtgaccggc
acgctggacctggccggcgcgctaggcgagagcgccgtgcgtttctcgcccgggctgctg
gcgcgcgcgcatctgggcgtgctctatgtggacgagatcaacctgctgcccgacggcctg
gtcgacgtgctgctcgacgcggccgcgagcggcgtcaacacggtcgagcgcgacggcatc
tcgcacacgcacgcggcgcgctttgcgctggtcggcaccatgaatccggaagagggcgag
ttgcgtccgcagttgctggatcgcttcggcttgatggtggaactcgagaactgtcgcgac
atcgctgagcggcagcgcatcgtcaaggcgcggctggccttcgatctcgatccggcgggc
ttccgcgccgggcatgccggggcactggccgcgctggccgaacggatcggccgcgcgcgc
gaggcgctggcgggcgtgcaggtcgacgacagcgtgcacgagcaggttgcccggctctgc
atcgaggcggccgtcgacgggctgcgcgccgacctggtgatgctgcgcgccgcgcgggcg
ctggccgccttcgagggcgcggcggcggtgagcgccgcgcatgtcgagcgcgtggccgcc
gacgtgctgcgccatcgccgcacgcaggcgtcggccgccgccgagtcgtcgtcacccacg
tcgtcgcccacgacgtcgccaaccgcgtcgcggcaaaccgatcagccggctcgcggcgcc
aacccgccgccgcgcggcggtgatgcctcgtcgatcgatcgagacgaggcgccagccggc
gacggcggcgcgcgggacggcgactggggctacctgccgcccgtaccggccggcctcacg
gccgtgaagggcgtgatcccgctgccctcaaaaaaacgctga

DBGET integrated database retrieval system