KEGG   Burkholderia gladioli: bgla_1g21180Help
Entry
bgla_1g21180      CDS       T01464                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bgd  Burkholderia gladioli
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    bgla_1g21180
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bgla_1g21180
  Lipid metabolism
   00071 Fatty acid degradation
    bgla_1g21180
  Amino acid metabolism
   00350 Tyrosine metabolism
    bgla_1g21180
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    bgla_1g21180
   00626 Naphthalene degradation
    bgla_1g21180
Enzymes [BR:bgd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     bgla_1g21180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2380256..2381248
Genome map
AA seq 330 aa AA seqDB search
MLAMSFEGDGTRSLRETQVPDPRPAPGQLLLDVRACGVCRTDLHILDSELAAPKRPLIPG
HEIVGTVSALGEGVTGFAPGDRVGVPWLGHTCGNCPYCRSGRENLCDRPGFTGYTIDGGY
AERAVADHRYCVHLPPRYSDLAAAPLLCAGLIGYRSLRMAGDARRIGIYGFGAAAHLVAQ
IARAEGRRVFALTSPGDLPAQRLALSLGAVWAGGSDEAPPEPLDAALIFAPVGALIPVAL
RSIEKGGIVVCGGIHMSDIPAFPYAWLWGERRVASVANLTRADALAFMRIAGAIPLQVQA
VPYALSDANRALDDLRHGRVSGAAVLRMRA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcgatgagtttcgagggggatgggacgcgaagcctgcgcgagacgcaggtgccc
gatccgcggccggcgccggggcagttgctgctggatgtgcgtgcctgcggcgtatgccgg
accgatctccacatccttgacagcgagttggccgccccgaaacggccgttgatccccggg
cacgaaatcgtcggcaccgtcagcgcgctgggcgagggcgtgacggggttcgcgccgggc
gatcgggtgggcgtgccatggctcggccacacctgcggcaactgcccgtattgccgttcc
gggcgggaaaacctgtgcgacaggccgggcttcaccggctacaccatcgacggcggctac
gcggaacgtgccgttgccgaccatcgatattgcgtgcatctgccgccgcgctactccgac
ctggcggccgcgccgctgctctgcgccggcctgatcggctaccgcagcctgcgcatggcc
ggcgacgcgcgacgcatcgggatctacgggttcggcgccgccgcgcacctggtcgcgcag
atcgcccgggccgaaggccggcgggtgttcgccctcaccagcccgggcgacctccctgcg
caacggcttgccttgtcgctcggcgcggtctgggcgggcggcagcgacgaagcgccgccg
gagccgctcgatgccgcgttgatcttcgcgccggtcggcgccttgatccccgtcgcgctt
cgctcgatcgagaagggcgggatcgtggtgtgcggcggcatccatatgagcgatattccc
gcctttccctacgcctggttatggggcgagcgccgtgtcgcctcggtcgccaacctgacg
cgcgcggacgccctcgcgttcatgcggatcgccggggcgatcccgctgcaggtgcaggcg
gtgccctatgcactgagcgatgccaatcgcgcgctcgacgatctgcgccatggccgggtg
tcgggcgccgcggtgctgcgcatgcgggcctga

DBGET integrated database retrieval system