KEGG   Burkholderia gladioli: bgla_1g22990Help
Entry
bgla_1g22990      CDS       T01464                                 

Definition
Protein-L-isoaspartate carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bgd  Burkholderia gladioli
Brite
Enzymes [BR:bgd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     bgla_1g22990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2642268..2643179)
Genome map
AA seq 303 aa AA seqDB search
MSGERAKRFPLALEDLKRAPRKSAARPNERHPSSPARPTLGASVAGSPARPAGLARAAHG
HGAAQAKGPANAAGTAAGSAGKPAVAGALALTSERVRERMVERLRANGVTDTRVLAAMAA
VPRHLFVDPGLAAQAYEDAALPIGHQQTISKPSVVARMIELALAGRVPERVLEIGTGCGY
QAAVLSHLTRDVYSIERVKPLFERAKRNLRPLRVPNIRLHYGDGRLGLPSAAPFDAIVIA
AAGLDVPQALLEQLTVGGRLVAPVGAQSGQPQVLTLVERVGPTQWRESRLDRVFFVPLKS
GVI
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgagcgcgccaagcggtttccgcttgcgctcgaggatctgaaacgtgcaccg
cgcaagagcgcggcgcgcccgaacgagcggcatccgagctcgccggcgcgcccgaccctg
ggcgcctccgtggccggctcgccggcccgcccggcgggcctcgcgcgcgccgcgcacggc
catggcgcggcccaggcgaaaggaccggcgaacgcggcggggacggctgccggcagtgcg
ggaaaacccgccgtcgcgggcgcgctggccttgacatcggaacgggtgcgcgagcgcatg
gtcgaacggctgcgcgccaacggcgtcaccgatacgcgcgtgctggcggcgatggccgcc
gtgccacgccacctgttcgtggatccgggcctggcggcccaggcctacgaggatgcggcg
ctgccgatcggccatcagcagacgatttccaagccttcggtggtggcccgcatgatcgag
ctcgcgctcgccgggcgcgttcccgagcgggtcctcgaaatcggcaccggctgcggttac
caggcagccgtactgagtcacctcacgcgcgacgtctattcgatcgagcgcgtgaagccg
ttgttcgaacgcgcgaaacgaaatctccggccgttgcgcgtgccgaacatccggctgcat
tacggcgatggccgcctgggcctgccgtcggccgcgccgttcgatgcgatcgtgatcgcg
gcggcggggctcgacgtgccgcaggcgctgctcgagcaactgacggtcggcggtcgcctg
gtcgcgccggtcggcgcgcagagcggccagccgcaggtcctgacgctggtcgagcgggtc
gggccgacccaatggcgggagtcgcggcttgatcgcgttttctttgtccctttaaaatcc
ggagtgatttga

DBGET integrated database retrieval system