KEGG   Burkholderia gladioli: bgla_1g23020Help
Entry
bgla_1g23020      CDS       T01464                                 

Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bgd  Burkholderia gladioli
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    bgla_1g23020
DNA repair and recombination proteins [BR:bgd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      bgla_1g23020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2645256..2645852)
Genome map
AA seq 198 aa AA seqDB search
MKQPSALSALVEALRVLPGVGPKSAQRMAYHLMQHDREGAEKLGRSLLFATEHLQHCEKC
NTFTESRICEVCSDTERDPSLLCVVETPADQIMLEQTLTYRGLYFVLMGRLSPLDGIGPK
EIHFDRLVRRASDGIVKEVVLATNFTNEGEATAHYLGQTLKARGLSVTRLARGVPVGGEL
EYVDAGTIARAMLDRRSM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagccctccgccctgtccgcccttgtcgaagcgctgcgcgtgctgcccggcgtc
gggccgaaatccgcgcagcggatggcgtatcacctgatgcagcacgatcgggagggcgcc
gagaagcttgggcgctcgctgctgttcgccaccgagcacctgcagcactgcgagaaatgc
aacaccttcaccgagtcgcgcatctgcgaggtctgcagcgataccgagcgtgatccgagc
ctgctgtgcgtggtcgagacgccggcggaccagatcatgctcgagcagacgctcacctat
cgcggcctctatttcgtgctgatggggcggctcagcccgctcgacggcatcggtcccaag
gaaatccatttcgaccggctggtgcgccgcgcctcggacggcatcgtcaaggaggtcgtg
ctcgcgaccaacttcacgaacgaaggcgaggcgaccgcccattacctcgggcagaccctc
aaggcgcgcggcctgtccgtcacgcggctcgcgcgcggcgtgccggtcggcggcgaactc
gaatacgtcgacgcgggcaccatcgcccgcgcgatgctcgaccgccggtcgatgtaa

DBGET integrated database retrieval system