KEGG   Burkholderia gladioli BSR3: bgla_1g23220Help
Entry
bgla_1g23220      CDS       T01464                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00260  Glycine, serine and threonine metabolism
bgd00750  Vitamin B6 metabolism
bgd01100  Metabolic pathways
bgd01110  Biosynthesis of secondary metabolites
bgd01120  Microbial metabolism in diverse environments
bgd01230  Biosynthesis of amino acids
Module
bgd_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bgla_1g23220
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    bgla_1g23220
Enzymes [BR:bgd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     bgla_1g23220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AEA60949
UniProt: F2LCR8
Position
1:complement(2668923..2670374)
Genome map
AA seq 483 aa AA seqDB search
MNYISTRGAGIGERYTFSDILLGGLAKDGGLYLPAEYPRVSAGELARWRELPYAELAFEV
LSKFSDDIPAEDLRELTRRTYRAEVYANTRHGENAADITPIKTLGSEGGTTLALLELSNG
PTLAFKDMAMQLLGNLFEYTLAKHGETLNILGATSGDTGSAAEYAMRGKAGVRVFMLSPH
RKMSAFQSAQMYSLQDPNIFNLAVEGVFDDAQDIVKAVSNDHAYKARHKIGTVNSINWAR
VVAQVVYYFKGYFAATRSNDERVSFTVPSGNFGNVCAGHIARMMGLPIEKLVVATNENDV
LDEFFRTGSYRVRGAEQTYHTSSPSMDISKASNFERFVFDLLGRDPARVLQLFHDVEHKG
GFDLAASGDFARVAEFGFVSGRSTHVDRLATIRDVHARYATMIDTHTADGVKVAREHLQP
GVPMVVLETAQPIKFGETIREALGREAERPAAFDGIEALPQRFEVVKADVQQVKDFIAAH
TGG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaattacatttcgacgcgcggcgccggcatcggcgagcgctatacgttttcggacatc
ctgctgggcggcctggccaaggacggcgggctctacctgccggccgaatacccgcgcgtg
agcgccggggaactggcgcgctggcgcgagctgccttacgcggagctggccttcgaggtg
ctctccaagttcagcgacgacatcccggccgaggacctgcgcgaactcacgcgccgcacc
tatcgcgccgaggtctacgccaacacgcgccatggcgagaacgccgccgacatcacgccg
atcaagacgctcggcagcgagggcggcaccacgctggcgctgctggaactgtcgaacggc
ccgaccctggcgttcaaggacatggccatgcagctgctcggcaacctgttcgagtacacg
ctggccaagcacggcgagaccctcaacatcctcggcgcgacctcgggcgacaccggcagc
gccgccgaatacgcgatgcgcggcaaggccggcgtgcgcgtgttcatgctatcgccgcac
cggaagatgagcgcgttccagtcggcgcagatgtacagcctgcaggatccgaacatcttc
aacctggccgtggaaggcgtgttcgacgacgcccaggacatcgtcaaggcggtctcgaac
gaccacgcctacaaggcgcgccacaagatcggcacggtcaactcgatcaactgggcacgg
gtggtcgcgcaggtcgtctactacttcaagggctacttcgccgcgacccgcagcaacgac
gagcgcgtctcgttcacggtgccctcgggcaacttcggcaacgtctgcgccggccatatc
gcgcgcatgatgggcctgccgatcgagaagctggtggtggccaccaacgagaacgacgtg
ctcgacgagttcttccgcaccggcagctaccgcgtgcgcggcgccgagcagacctatcac
accagcagccccagcatggatatctcgaaggcctccaacttcgagcgcttcgtgttcgac
ctgctgggccgcgatccggcgcgcgtgctgcaactgttccacgacgtcgagcacaagggc
ggcttcgatctcgccgcgagcggcgatttcgcgcgcgtggccgagttcggcttcgtctcg
ggccgcagcacgcacgtggatcgcctggcgacgatccgcgatgtccacgcgcgctacgcg
accatgatcgacacgcacacggccgacggcgtgaaggtggcgcgcgagcacctgcagccg
ggcgtgccgatggtggtgctggagaccgcccagccgatcaagttcggcgagacgatccgc
gaggcgctgggccgagaggccgagcgtcccgccgcgttcgacggcatcgaggcgctgccg
cagcgcttcgaggtggtgaaggccgatgtgcagcaggtgaaggacttcatcgccgcgcat
accggcggctga

DBGET integrated database retrieval system