KEGG   Burkholderia gladioli: bgla_1g23720Help
Entry
bgla_1g23720      CDS       T01464                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bgd  Burkholderia gladioli
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    bgla_1g23720
Enzymes [BR:bgd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     bgla_1g23720
    3.5.1.-  
     bgla_1g23720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2719746..2720369)
Genome map
AA seq 207 aa AA seqDB search
MRSDDVLLVIDVQNDFMPGGALAVADGDAVVPVINRLARRFEQVVITQDWHPRAHVSFAA
NHPGREPFSTISLPYGEQVLWPVHCVQDSEGAALHSELDIPQARLVIRKGLDVSIDSYSA
FVEADRSTPTGLAGYLAALGAKRVWCCGLATDYCVAWSALDARAAGFEAAVIEDACRAID
LNGSLARAWQELQAAGVARVQAQAVLA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagcgacgatgtgctgctcgtgatcgacgtgcagaacgatttcatgccgggcggc
gcgctcgcggtggccgacggcgacgcggtggtgccggtgatcaaccggctcgcgcggcgc
ttcgagcaggtggtgatcacgcaggactggcatccgcgcgcgcacgtgtcgttcgccgcc
aaccacccgggccgcgagccgttctcgacgatttccctgccttacggcgaacaggtgctg
tggcccgtgcattgcgtgcaggacagcgagggcgcagcgctgcatagcgagctcgacatc
ccgcaggcgcggctggttatccgcaagggcctcgacgtctcgatcgacagctattcggcc
ttcgtcgaggccgatcgcagcacgcccaccgggctggcgggttacctcgccgcgctcggc
gcgaaacgcgtctggtgctgcgggctggccaccgactactgcgtggcctggtccgcgctc
gatgcgcgcgcggccggtttcgaggccgccgtgatcgaggacgcctgccgcgcgatcgac
ctgaacggctcgctggcgcgggcatggcaagaacttcaggccgcgggcgtggcccgcgtc
caggcgcaggcggtgctcgcctga

DBGET integrated database retrieval system