KEGG   Burkholderia gladioli: bgla_1g23870Help
Entry
bgla_1g23870      CDS       T01464                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bgd  Burkholderia gladioli
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    bgla_1g23870
Enzymes [BR:bgd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     bgla_1g23870
   3.1.2  Thioester hydrolases
    3.1.2.-  
     bgla_1g23870
Lipid biosynthesis proteins [BR:bgd01004]
 Fatty acid synthase
  Component type
   bgla_1g23870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2742515..2743219
Genome map
AA seq 234 aa AA seqDB search
MKQSDSWKDGLRAVVIALAATAGFGGIGAAAQAATQAAAPAATSTSAAKPNIVVLGDSLS
AEYGLPRDTGWVALMRARIADQRIDYSVANASVSGDTTNGGRARLPAVLTRLKPSILIVE
LGANDALRGVPLATTEQNLRAIVAQAQQAKAKVVLVGMYVPPNYGLDYTQKFHAMYGTLA
KELRLPLVPFLLAGLEDKPDQFQDDQNHPNQGAQPRLLDNVWPVVKPLLGPGAH
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagagtgattcctggaaagacggcctgcgcgccgtcgtgatcgccctggccgcc
acggccgggttcggcggcatcggtgccgccgcgcaggcagccacgcaagcggccgcgcct
gcggctacctcaaccagcgcggccaagcccaacatcgtggtgctcggcgacagcctgtcc
gccgaatacggcctgccgcgcgacacgggctgggtcgcgctgatgcgcgcgcgcatcgcg
gatcagcgaatcgattatagcgtcgcgaatgccagcgtcagcggcgacaccaccaatggc
ggccgggcccgcctgcccgccgtgctcacgcgcctgaagccctcgatcctgatcgtcgag
ctgggcgccaacgacgcgctgcgcggcgtgccgctggccaccaccgagcagaacctgcgc
gcgatcgtggcgcaggcgcagcaggccaaggcgaaggtggtgctggtcggcatgtacgtg
ccgcccaactacggcctcgattacacgcagaagttccacgccatgtacggcacgctcgcg
aaggagctgcgcctgccgctggtgcccttcctgctggccggcctcgaggacaagcccgac
cagttccaggacgaccagaaccacccgaaccagggcgcgcagcccaggctgctcgacaac
gtctggccggtggtgaagccgctgctgggtccgggcgcgcactaa

DBGET integrated database retrieval system