KEGG   Burkholderia gladioli: bgla_1g23870Help
Entry
bgla_1g23870      CDS       T01464                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bgd  Burkholderia gladioli
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bgd01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2742515..2743219
Genome map
AA seq 234 aa AA seqDB search
MKQSDSWKDGLRAVVIALAATAGFGGIGAAAQAATQAAAPAATSTSAAKPNIVVLGDSLS
AEYGLPRDTGWVALMRARIADQRIDYSVANASVSGDTTNGGRARLPAVLTRLKPSILIVE
LGANDALRGVPLATTEQNLRAIVAQAQQAKAKVVLVGMYVPPNYGLDYTQKFHAMYGTLA
KELRLPLVPFLLAGLEDKPDQFQDDQNHPNQGAQPRLLDNVWPVVKPLLGPGAH
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagagtgattcctggaaagacggcctgcgcgccgtcgtgatcgccctggccgcc
acggccgggttcggcggcatcggtgccgccgcgcaggcagccacgcaagcggccgcgcct
gcggctacctcaaccagcgcggccaagcccaacatcgtggtgctcggcgacagcctgtcc
gccgaatacggcctgccgcgcgacacgggctgggtcgcgctgatgcgcgcgcgcatcgcg
gatcagcgaatcgattatagcgtcgcgaatgccagcgtcagcggcgacaccaccaatggc
ggccgggcccgcctgcccgccgtgctcacgcgcctgaagccctcgatcctgatcgtcgag
ctgggcgccaacgacgcgctgcgcggcgtgccgctggccaccaccgagcagaacctgcgc
gcgatcgtggcgcaggcgcagcaggccaaggcgaaggtggtgctggtcggcatgtacgtg
ccgcccaactacggcctcgattacacgcagaagttccacgccatgtacggcacgctcgcg
aaggagctgcgcctgccgctggtgcccttcctgctggccggcctcgaggacaagcccgac
cagttccaggacgaccagaaccacccgaaccagggcgcgcagcccaggctgctcgacaac
gtctggccggtggtgaagccgctgctgggtccgggcgcgcactaa

DBGET integrated database retrieval system