KEGG   Burkholderia gladioli: bgla_1g24530Help
Entry
bgla_1g24530      CDS       T01464                                 

Definition
class II aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bgd  Burkholderia gladioli
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    bgla_1g24530
Enzymes [BR:bgd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     bgla_1g24530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2816514..2817296)
Genome map
AA seq 260 aa AA seqDB search
MPETLHLSKSELVARSHQQLDTALSSRDWSPRQKLALTCRILFDGGHDSGLAGQITARAE
DRDTYYTQPFGQGFDEITEQNLLLVDQDLKTIGGEGIPNPANRFHTWIYRARPDVNCIIH
THPVHVSALSMLELPLAVSHMDMCPLHDDCAFLETWPGVPVGNEEGEIISAALGDKRAVL
LAHHGMLVTGKTIEEACVLALLMERAARLQLLAQAAGTIRPIPEALAREAHDWITTPKRH
AVTFDYYARRALRAHRDCLA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaacgctgcacttgtcgaagtccgagctggtcgcccgctcgcaccagcaactc
gataccgcgctgtcgtcgcgcgactggtcgcctcgacagaaactggcactgacctgccgc
attctatttgatggcggccacgattcggggctcgcgggccagatcaccgcgcgcgccgag
gatcgcgacacctattacacccagcccttcgggcagggcttcgacgagatcaccgagcag
aacctgctgctggtcgaccaggacctgaagacgatcggcggcgagggcatcccgaacccg
gccaatcgcttccatacctggatctatcgcgcgcggcccgatgtcaactgcatcatccac
acccatcccgtgcacgtctcggcgctgtcgatgctggagctgccgctggcggtctcgcac
atggacatgtgcccgctgcacgacgactgcgccttcctcgagacctggcccggcgtgccg
gtcggcaacgaggaaggcgagatcatctcggccgcgctcggcgacaagcgcgccgtgctg
ctggcccatcacggcatgctggtgaccggcaagaccatcgaggaggcctgcgtgctggcg
ctgctgatggagcgcgcggctcgcctgcagttgctggcacaggccgccgggacgatccgg
ccgattcccgaggcgctggccagggaggcgcacgactggatcaccacgcccaagcgccat
gccgtcaccttcgactattacgcgcgccgcgccctgcgcgcgcatcgcgactgcctggcc
tga

DBGET integrated database retrieval system