KEGG   Burkholderia gladioli BSR3: bgla_1g25620Help
Entry
bgla_1g25620      CDS       T01464                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00900  Terpenoid backbone biosynthesis
bgd01100  Metabolic pathways
bgd01110  Biosynthesis of secondary metabolites
bgd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    bgla_1g25620
Enzymes [BR:bgd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     bgla_1g25620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh Sacchrp_dh_NADP XdhC_C FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AEA61182
UniProt: F2LFL6
Position
1:complement(2936501..2937697)
Genome map
AA seq 398 aa AA seqDB search
MQKRLTILGSTGSIGDSTLDVVARHPDRFSVYALSAHRNGDKLVEQCLKFRPEVAVVGSA
ETAAAVEAKLRAAGCRTQVAHGPDALVEIARADGCDTVVAAIVGAAGLASSLAAARAGKR
ILLANKESLVMSGSIFMDAVRDHGAILLPVDSEHNAIFQCMPRDIAEHGGIAKIIVTASG
GPFRTREPATLVDVTPDEACKHPNWSMGRKISVDSATMMNKGLEVIEAHWIFGLPSQRIE
VLIHPQSVIHSLVSYKDGSVLAQLGNPDMRTPIAHALAFPERVDAGVAQLDLAQVATLNF
EKPDFQRFPCLALAIQALDAGGVASTVLNAANELAVEAFLERRIGFMDIASTVDAVLNHL
TNREPDGLDDVLAADAEARREAAAVIAKLPVPRAERVA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacgcctgactatcctgggctcgacgggctcgatcggagacagcacgctcgac
gtcgtcgcgcgtcacccggaccgcttctcggtctatgcgctgagcgcgcaccgcaacggc
gacaagctcgtcgagcagtgcctgaagttccggcccgaagtggccgtggtcggctcggcg
gaaaccgccgccgcggtcgaggccaagctgcgcgcggccggttgccgtacccaggtcgcc
catggcccggacgcgctggtcgagatcgcccgggccgacggctgcgatacggtggtcgcc
gcgatcgtcggcgccgccggcctggcctcgagcctggccgccgctcgcgccggcaagcgc
atcctgcttgccaacaaggaatcgctggtgatgtcgggctcgatcttcatggacgcggtg
cgcgaccatggcgcgatcctgctgccggtcgacagcgagcacaacgcgatcttccagtgc
atgccgcgcgacatcgccgagcacggcggcatcgccaagatcatcgtgaccgcctcgggc
ggcccgttccgcacccgcgagccggccaccctggtcgacgtcacgccggacgaggcctgc
aagcacccgaactggtcgatgggccgcaagatctcggtggattcggccaccatgatgaac
aagggcctggaggtgatcgaggcgcactggatcttcggcttgccgagccagcgcatcgag
gtgctgatccatccgcagagcgtgatccattcgctggtctcgtacaaggacggctcggtg
ctcgcgcaactgggcaaccccgacatgcgcacgccgatcgcgcatgcgctggctttcccg
gagcgcgtcgacgccggcgtcgcccagctcgacctggcccaggtcgccaccctgaacttc
gagaagccggacttccagcgcttcccctgcctggccctggcgatccaggcgctcgacgcg
ggcggggtggccagcacggtgctcaacgccgccaacgaactggcggtggaagccttcctg
gagcgccggatcggcttcatggatatcgcgagcacggtcgatgcggtgctcaatcatctg
acgaatcgcgagccggacggtctcgacgacgtgctggcggccgatgccgaggcgcgccgc
gaggccgccgcggtgatcgcgaaactgcctgttccgcgcgcggagcgcgtagcctga

DBGET integrated database retrieval system