KEGG   Burkholderia gladioli: bgla_1g26010Help
Entry
bgla_1g26010      CDS       T01464                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bgd  Burkholderia gladioli
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bgla_1g26010
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    bgla_1g26010
   00630 Glyoxylate and dicarboxylate metabolism
    bgla_1g26010
Enzymes [BR:bgd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     bgla_1g26010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2982829..2984421
Genome map
AA seq 530 aa AA seqDB search
MTTTLKLPQGMAITGEIRPGYDAILTPEALELVARLHRAFEPRRQELLKLRAERTRRLDA
GERPDFLADTQAVRDGDWKVAPLPADLQCRRVEITGPVERKMIINALNSGADSYMTDFED
SNAPVWTNQLDGQINLFDAVRKTISLEQNGKSYRLNERVATLIVRPRGWHLDEKHVTVDG
QRVSGGVFDFALYLFHNAKELLSRGSGPYFYLPKMESHLEARLWNDIFVAAQEAIGVPRG
TIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKNDREFCLADRSKI
TMTVPFMRAYALLLLKTCHKRGAPAIGGMSALIPIKNDPEANDKAMGGVRSDKARDAGDG
YDGGWVAHPGLVPIAMEEFVKVLGDRPNQIDKQRDDVQIEGRNLLDFQPEAPITEAGLRN
NINVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGVLDDGRKVTAEMV
REYAKVELDKVKQVVAGDTQPYERAAAIFESMSTSESFTEFLTLPLYEEI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccacgctgaagctgccgcaaggcatggcgatcacgggcgagatccgccccggc
tacgacgcgatcctgacgcccgaggcgctcgaactcgtcgcccggctgcaccgtgccttc
gagccgcgccgccaggaactgctgaagctgcgcgccgagcgcacgcggcgcctggacgcc
ggcgagcgcccggacttcctcgcggacacccaggcggtccgcgacggcgactggaaggtc
gcgccgctgccggccgacctgcaatgccgccgcgtcgagatcaccgggccggtcgagcgc
aagatgatcatcaacgcgctgaactcgggcgcggattcctacatgacggacttcgaggat
tcgaacgcgccggtgtggaccaaccagctcgacggccagatcaacctgttcgacgcggtg
cgcaagaccatctcgctggagcagaacggcaagtcgtaccggctcaacgagcgcgtggcc
acgctgatcgtgcgcccgcgcggctggcacctcgacgagaagcacgtcacggtggacggc
cagcgcgtctcgggcggcgtgttcgacttcgcgctctacctgttccacaacgcgaaggaa
ctgctctcgcgcggctcgggcccctacttctacctgccgaagatggaaagccacctggag
gcgcgcctctggaacgacatcttcgtggccgcccaggaggcgatcggcgtgccgcgcggc
acgatccgcgccaccgtgctgatcgagaccatcctggccgccttcgagatggacgagatc
ctgtacgagctgcgcgagcacagctcgggcctcaacgccggccgctgggactacatcttc
tcggccatcaagaagttcaagaacgaccgcgagttctgcctggccgaccgctcgaagatc
accatgacggtgcccttcatgcgcgcctacgcgctgctgctgctgaagacctgtcacaag
cgcggcgcgccggcgatcggcggcatgagcgcgctgatcccgatcaagaacgatccggaa
gcgaacgacaaggcgatgggcggcgtgcgctcggacaaggcgcgcgatgccggcgacggc
tacgacggcggctgggtcgcgcacccgggcctggtgccgatcgcgatggaggaattcgtc
aaggtgctgggcgatcgcccgaaccagatcgacaagcagcgcgacgacgtgcagatcgaa
ggccgcaacctgctcgacttccagccggaagcgccgatcaccgaggcgggcctgcgcaac
aacatcaacgtcgggatccactacctgggctcctggctagccggcaacggctgcgtgccg
atccacaacctgatggaggatgctgccaccgccgagatctcgcgctcgcaggtctggcaa
tggatccgctcgccgaagggcgtgctcgacgacggtcgcaaggtcacggccgagatggtg
cgcgagtacgcgaaggtcgagctcgacaaggtcaagcaggtggtggcgggcgatacccag
ccctatgagcgcgccgccgcgatcttcgagagcatgtccacctcggaatccttcaccgaa
ttcctgacgctgccgctctacgaggagatctga

DBGET integrated database retrieval system