KEGG   Burkholderia gladioli: bgla_1g28900Help
Entry
bgla_1g28900      CDS       T01464                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bgd  Burkholderia gladioli
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bgd00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bgd00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3292447..3293235)
Genome map
AA seq 262 aa AA seqDB search
MDSKLGGKVAVVTGAASGIGKEIALELARAGAAVAIADLNQDGANAVAEQIKAAGGKAIG
VAMDVTNEDAVNAGIDKVAAEFGSVDILVSNAGIQIVNPIENYSFSDWKKMQAIHVDGAF
LTTKAVLKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNV
RSHVVCPGFVRTPLVDKQIPEQAQELGISEEDVIKKVMLGNTVDGVFTTVEDVAKTVLFL
SAFPSAALTGQSFVVSHGWFMQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggattcgaaactgggcggcaaggttgccgtggtcaccggcgccgcgagcggcatcggc
aaggaaatcgcgctggaactggccagggcgggcgccgccgtggcgatcgccgacctgaac
caggacggcgcgaacgccgtggccgagcagatcaaggcggccggcggcaaggcgatcggc
gtggcgatggacgtcaccaacgaggacgccgtcaatgccggcatcgacaaggtcgccgcc
gagttcggctcggtcgacatcctggtctcgaacgcgggcatccagatcgtcaatccgatc
gagaactactcgttctcggactggaagaagatgcaggcgatccacgtcgacggcgccttc
ctgaccaccaaggccgtgctcaagcacatgtacaaggacgatcgcggtggcgtggtgatc
tacatgggctcggtgcactcgcacgaggcctcgccgctgaagtcggcctacgtgacggcc
aagcacggcctgctgggtttggcgcgcgtgctggccaaggaaggcgcgaagcacaacgtg
cgctcgcatgtggtctgcccgggcttcgtgcgcacgccgctggtcgacaagcagatcccc
gagcaggcccaggagctcggtatcagcgaggaggacgtcatcaagaaggtgatgctcggc
aataccgtcgacggcgtattcaccacggtggaagacgtcgccaagacggtgctgttcctg
tcggccttcccgagcgccgcgctcacgggccaatccttcgtggtcagccacggctggttc
atgcagtaa

DBGET integrated database retrieval system