KEGG   Burkholderia gladioli: bgla_1g29310Help
Entry
bgla_1g29310      CDS       T01464                                 

Definition
Triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bgd  Burkholderia gladioli
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bgla_1g29310
   01230 Biosynthesis of amino acids
    bgla_1g29310
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bgla_1g29310
   00051 Fructose and mannose metabolism
    bgla_1g29310
   00562 Inositol phosphate metabolism
    bgla_1g29310
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    bgla_1g29310
Enzymes [BR:bgd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     bgla_1g29310
Exosome [BR:bgd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   bgla_1g29310
  Exosomal proteins of bladder cancer cells
   bgla_1g29310
  Exosomal proteins of melanoma cells
   bgla_1g29310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3336004..3336759)
Genome map
AA seq 251 aa AA seqDB search
MSTQRVKRVVGNWKMHGRLDGNRALLNEVLEGAKGVQAGVEIGVCVPFPYLAQVGELLQG
SRVVAGSQDVSAHEQGAYTGEVAAAMIAEFGAKYALVGHSERRTYHGESSDLVAVKAQRA
LAAGLTPIVCVGETLAERESNATEQVVGAQLDAVLALLSAEEAARIVVAYEPVWAIGTGK
SASSEQAQQVHAFLRSRLAAKGVEQVSVLYGGSVKPDNAAELFGQPDIDGGLIGGASLKS
NDFLAICRAAK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtccacacaacgagtgaaacgggtagtcggtaactggaagatgcacggccgtctcgac
ggcaatcgcgcgctgctcaacgaagtgctcgagggcgcgaagggcgtgcaggccggtgtc
gagatcggggtgtgcgtgccgttcccgtatctggcccaggtgggcgagctgctgcagggc
agccgcgtggtagcggggtcgcaggacgtgtcggcccacgagcagggcgcctacacgggc
gaggtggccgcggcgatgatcgccgagttcggtgcgaagtacgcgctggtcggccattct
gagcgtcgcacctaccacggcgaatcgagcgacctggttgcggtgaaggcgcagcgcgcg
ctggcggccggcctgacgccgatcgtctgcgtcggcgagaccctggccgagcgtgagtcg
aatgcgaccgagcaggtggtcggcgcgcagctcgacgcggtgctcgcgctgctgtcggcc
gaggaggcggcgcgcatcgtggtggcctacgagccggtctgggcgatcggcacgggcaag
agcgcgagttcggagcaggcacagcaggtgcacgccttcctgcgttcgcggctggccgcc
aagggtgtcgagcaggtgtcggtgctgtacggcggcagcgtgaagccggacaatgcggcc
gaactgttcggccagccggacatcgacggcggcctgatcggcggcgcgtcgctcaagagc
aatgatttcctggcgatctgccgcgcggcgaagtaa

DBGET integrated database retrieval system