KEGG   Burkholderia gladioli BSR3: bgla_1g29310Help
Entry
bgla_1g29310      CDS       T01464                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00010  Glycolysis / Gluconeogenesis
bgd00051  Fructose and mannose metabolism
bgd00562  Inositol phosphate metabolism
bgd00710  Carbon fixation in photosynthetic organisms
bgd01100  Metabolic pathways
bgd01110  Biosynthesis of secondary metabolites
bgd01120  Microbial metabolism in diverse environments
bgd01130  Biosynthesis of antibiotics
bgd01200  Carbon metabolism
bgd01230  Biosynthesis of amino acids
Module
bgd_M00002  Glycolysis, core module involving three-carbon compounds
bgd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bgla_1g29310
   00051 Fructose and mannose metabolism
    bgla_1g29310
   00562 Inositol phosphate metabolism
    bgla_1g29310
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    bgla_1g29310
Enzymes [BR:bgd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     bgla_1g29310
Exosome [BR:bgd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   bgla_1g29310
  Exosomal proteins of bladder cancer cells
   bgla_1g29310
  Exosomal proteins of melanoma cells
   bgla_1g29310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEA61543
UniProt: F2LDY9
Position
1:complement(3336004..3336759)
Genome map
AA seq 251 aa AA seqDB search
MSTQRVKRVVGNWKMHGRLDGNRALLNEVLEGAKGVQAGVEIGVCVPFPYLAQVGELLQG
SRVVAGSQDVSAHEQGAYTGEVAAAMIAEFGAKYALVGHSERRTYHGESSDLVAVKAQRA
LAAGLTPIVCVGETLAERESNATEQVVGAQLDAVLALLSAEEAARIVVAYEPVWAIGTGK
SASSEQAQQVHAFLRSRLAAKGVEQVSVLYGGSVKPDNAAELFGQPDIDGGLIGGASLKS
NDFLAICRAAK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtccacacaacgagtgaaacgggtagtcggtaactggaagatgcacggccgtctcgac
ggcaatcgcgcgctgctcaacgaagtgctcgagggcgcgaagggcgtgcaggccggtgtc
gagatcggggtgtgcgtgccgttcccgtatctggcccaggtgggcgagctgctgcagggc
agccgcgtggtagcggggtcgcaggacgtgtcggcccacgagcagggcgcctacacgggc
gaggtggccgcggcgatgatcgccgagttcggtgcgaagtacgcgctggtcggccattct
gagcgtcgcacctaccacggcgaatcgagcgacctggttgcggtgaaggcgcagcgcgcg
ctggcggccggcctgacgccgatcgtctgcgtcggcgagaccctggccgagcgtgagtcg
aatgcgaccgagcaggtggtcggcgcgcagctcgacgcggtgctcgcgctgctgtcggcc
gaggaggcggcgcgcatcgtggtggcctacgagccggtctgggcgatcggcacgggcaag
agcgcgagttcggagcaggcacagcaggtgcacgccttcctgcgttcgcggctggccgcc
aagggtgtcgagcaggtgtcggtgctgtacggcggcagcgtgaagccggacaatgcggcc
gaactgttcggccagccggacatcgacggcggcctgatcggcggcgcgtcgctcaagagc
aatgatttcctggcgatctgccgcgcggcgaagtaa

DBGET integrated database retrieval system