KEGG   Burkholderia gladioli BSR3: bgla_1g33400Help
Entry
bgla_1g33400      CDS       T01464                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bgla_1g33400
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    bgla_1g33400
   00640 Propanoate metabolism
    bgla_1g33400
   00660 C5-Branched dibasic acid metabolism
    bgla_1g33400
Enzymes [BR:bgd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     bgla_1g33400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3787749..3788915)
Genome map
AA seq 388 aa AA seqDB search
MKIHEYQGKEILRKFGVAVPRGKPAFSVEDAVKVAEELGGPVWVVKAQIHAGGRGKGGGV
KVAKSIEQVREYASQILGMQLVTHQTGPEGQKVNRLMVEEGADIKQELYVSLVVDRVSQK
IVLMGSSEGGMDIEEVAEKHPELIHQVIVEPSTGLLDAQADDLAAKIGVPAASIPQARAI
LQGLYKAFWETDASLAEINPLNVSSDGKVTALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKLMLKNPDLKAILVNIFGGIMRCDVIAEGVIAGSKAVNLGVPLVVRMKGTNEDLGKKM
LAESGLPIISADSMEEAAQKVVAAAAGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtaccagggtaaggaaatcctgcggaaattcggagtcgcggtcccg
cgcggcaagccggcgttctcggttgaagatgccgtcaaggtggcagaagagctgggcggc
ccggtgtgggtcgtgaaggctcagattcacgcgggtggccgtggcaagggcggcggcgtg
aaggtggcgaagtcgatcgagcaggttcgcgagtacgcgagccagatcctcggcatgcag
ctcgtcacccaccagaccggcccggaaggccagaaggtcaaccgcctgatggtcgaggaa
ggcgccgacatcaagcaggaactgtatgtcagcctcgtcgtcgatcgcgtgtcgcaaaag
atcgtcctgatgggttcgagcgaaggcggcatggacatcgaggaagtggccgaaaagcat
ccggagctgatccaccaggtcatcgtcgagccgtcgaccggcctgctcgatgcacaggcc
gacgacctcgccgcgaagatcggcgtgccggctgcctcgattccgcaagcgcgcgcgatc
ctgcaaggcctgtacaaggcgttctgggaaaccgacgcgtcgctggccgaaatcaatccg
ctgaacgtctccagcgacggcaaggtcaccgccctcgacgcgaagttcaacttcgattcg
aacgcgctgttccgtcacccggaaatcgtcgcctaccgcgatctggacgaagaagatccg
gctgaaatcgaggcttcgaagttcgatctcgcctacatctcgctggacggcaacatcggc
tgcctggtgaatggcgccggcctggcgatggccaccatggacaccatcaagctgttcggc
ggcgaaccggcgaacttcctggacgtcggcggtggcgcgacgaccgagaaggtcacggaa
gcgttcaagctgatgctgaagaacccggacctgaaggcaatcctggtcaacatcttcggc
ggcatcatgcgctgcgacgtgatcgccgaaggcgtgatcgccggctcgaaggccgtgaac
ctcggcgtgccgctggtggtgcgcatgaagggcaccaacgaagacctgggcaagaagatg
ctggccgagtcgggcctgccgatcatctcggcggacagcatggaagaagccgcgcagaag
gtcgtcgcggcagccgccggcaagtaa

DBGET integrated database retrieval system