KEGG   Burkholderia gladioli: bgla_1g33990Help
Entry
bgla_1g33990      CDS       T01464                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bgd  Burkholderia gladioli
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    bgla_1g33990
Enzymes [BR:bgd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     bgla_1g33990
Exosome [BR:bgd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   bgla_1g33990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3860204..3861706
Genome map
AA seq 500 aa AA seqDB search
MQGQYILALDQGTTSSRAMLFDRQGNIVSIAQKEFEQIYPRPGWVEHDPQEIWSTQAGVA
AEAVTRVGLNGTAIAAIGITNQRETTIVWDRETGQPIYNAIVWQDRRTADFCDSLKADGL
EAMVRAKTGLPIDSYFSGTKIRWILDNVEGAREKARQGRLAFGTVDSWLVWNFTKHELHV
TDVTNASRSMLFNIHTRQWDDELLAALDIPRSMLPEVRASSEIYGHTKTTVFASKLPLAG
IAGDQQAALFGQMCTSSGMVKNTYGTGCFLMMNTGDKPIESKNNLVTTIAWQVGDQVNYA
LEGSIFIAGAVVQWLRDGLGIIKSASEIEKLAASVPHTDGVYLVPAFAGLGAPHWNARAR
GSLFGVTRGTSDAHLARAALDSIAYQSLDVLAAMEADSGISIGELRVDGGASANNLLMQF
QADLLGVDAVRPQITETTALGAAYLAGLAIGYWQNLDEVRSQWQLDTRFSPSMPAEQVST
ALAGWQRAVRAAKAWADDTR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcagggtcaatacatcctcgcactcgaccagggcacgacgagctcgcgcgcgatgctg
ttcgatcgccagggcaacatcgtatcgatcgcccagaaggagttcgagcagatctatcct
cgcccgggctgggtggagcacgatccccaggaaatctggtcgacccaggccggcgtcgcc
gccgaggcggtcacgcgcgtgggcctgaacggcaccgcgatcgcggcgatcggcatcacc
aaccagcgcgagaccaccatcgtctgggatcgcgagaccggccagccgatctacaacgcg
atcgtgtggcaggaccgccgcaccgccgacttctgcgactcgctcaaggccgacggcctg
gaagcgatggtgcgcgccaagaccggcctgccgatcgactcctacttctccggtaccaag
atccgctggatcctcgacaacgtcgagggcgcgcgcgagaaggcgcgccagggccggctc
gcgttcggcacggtcgatagctggctggtctggaacttcaccaagcacgagctgcacgtc
accgacgtgaccaacgcctcgcgcagcatgctgttcaacatccatacgcgccagtgggac
gacgagctgctggccgcgctcgacatcccgcgcagcatgctgcccgaggtgcgcgcctcc
tccgagatctacggtcacaccaagaccaccgtgttcgcctccaagctgccgctggccggc
atcgcgggcgaccagcaggcggccctgttcggccagatgtgcaccagttcggggatggtg
aagaacacctacggcaccggctgcttcctgatgatgaacaccggcgacaagccgatcgag
tcgaagaacaacctggtgaccaccatcgcctggcaggtcggcgaccaggtgaactacgcg
ctggaaggcagcatcttcatcgccggcgcggtggtgcaatggctgcgcgacggcctgggc
atcatcaagtcggccagcgagatcgagaagctggcggccagcgtgccgcataccgacggc
gtctacctggtgccggccttcgccggcctgggcgcgccgcactggaacgcccgcgcgcgc
ggctcgctgttcggcgtcacgcgcggcaccagcgacgcccacctggcgcgcgcggcgctc
gactcgatcgcctaccagtcgctcgacgtgctggcggcgatggaagccgattcgggcatc
agcatcggcgagctgcgggtggacggcggcgccagcgccaacaacctgctgatgcagttc
caggcggacctgctcggcgtggacgcggtgcgcccgcagatcaccgagaccaccgcgctc
ggcgcggcctacctggcgggcctggcgatcggctactggcagaacctcgacgaggtgcgc
agccaatggcagctcgacacgcgcttctcgccgtcgatgccggccgagcaggtcagcacg
gcgctggccggctggcagcgcgcggtacgcgccgccaaggcctgggccgacgacacgcgc
taa

DBGET integrated database retrieval system