KEGG   Burkholderia gladioli: bgla_1g34970Help
Entry
bgla_1g34970      CDS       T01464                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bgd  Burkholderia gladioli
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bgd00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3974008..3974886
Genome map
AA seq 292 aa AA seqDB search
MTDTSRSLRDCLAPAKLNLFLHVTGRRPDGYHSLQTVFQLLDWGDRLHYTLREDGAVHRL
TEVAGVPEEQDLVVRAARLLQAHTGTTLGVDIEIDKVLPMGAGLGGGSSDAATTLLALNR
LWNLDLPRAELQALAVKLGADVPFFVFGKNAFAEGIGEALEQVELPARWFLVVTPRVHVP
TAEIFSDKSLTRDSRPITITDFLAQQSSKGWPDSFGQNDMQAVVTKKYAEVAKVVKALYD
LTPSRMTGSGASVFAAFGSKQEAQAAQATLPTGWNSAVTGSLGEHPLFAFAS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatacatcccgctcgctgcgcgactgcctcgccccggcgaaactcaacctgttc
ctgcacgtcacgggccgccgcccggatggttatcactcgctgcagaccgtgttccagttg
ctcgactggggcgaccggctgcactacacgctgcgcgaggacggtgcggtccaccgcctc
accgaggtggcgggcgtgcccgaggaacaggacctggtggtgcgcgccgcgcgcctgctg
caggctcacacgggcaccacgctcggcgtcgacatcgagatcgacaaggtgctgccgatg
ggcgcgggcctgggcggcggcagctccgacgcggccaccaccctgctcgccctgaaccgc
ctctggaatctcgacctgccgcgcgctgaacttcaggcgctggccgtgaaactgggcgcc
gacgtgcccttcttcgtgttcggaaaaaatgcgttcgcggagggtatcggagaggcactg
gagcaggtagaattgccggctcgctggttcctggttgtgacgcctcgagttcacgtaccg
accgctgaaattttttcagataagtcgttgacaagagattcgagacccatcacaattacg
gactttcttgcacagcaaagcagcaagggttggccagacagcttcggccaaaacgacatg
caggcggttgtgacaaagaagtacgcggaagttgcaaaggtagtcaaagcgttgtatgat
ttgaccccttcgcggatgaccggctctggagctagtgtcttcgcagcgttcggtagcaag
caggaggcgcaggcagcacaagccaccttgccgacaggctggaacagcgctgttaccgga
agcctgggtgaacatccactcttcgctttcgcgtcataa

DBGET integrated database retrieval system