KEGG   Burkholderia gladioli BSR3: bgla_1g34970Help
Entry
bgla_1g34970      CDS       T01464                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00900  Terpenoid backbone biosynthesis
bgd01100  Metabolic pathways
bgd01110  Biosynthesis of secondary metabolites
bgd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    bgla_1g34970
Enzymes [BR:bgd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     bgla_1g34970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C PYC_OADA
Motif
Other DBs
NCBI-ProteinID: AEA62100
UniProt: F2LD13
Position
1:3974008..3974886
Genome map
AA seq 292 aa AA seqDB search
MTDTSRSLRDCLAPAKLNLFLHVTGRRPDGYHSLQTVFQLLDWGDRLHYTLREDGAVHRL
TEVAGVPEEQDLVVRAARLLQAHTGTTLGVDIEIDKVLPMGAGLGGGSSDAATTLLALNR
LWNLDLPRAELQALAVKLGADVPFFVFGKNAFAEGIGEALEQVELPARWFLVVTPRVHVP
TAEIFSDKSLTRDSRPITITDFLAQQSSKGWPDSFGQNDMQAVVTKKYAEVAKVVKALYD
LTPSRMTGSGASVFAAFGSKQEAQAAQATLPTGWNSAVTGSLGEHPLFAFAS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatacatcccgctcgctgcgcgactgcctcgccccggcgaaactcaacctgttc
ctgcacgtcacgggccgccgcccggatggttatcactcgctgcagaccgtgttccagttg
ctcgactggggcgaccggctgcactacacgctgcgcgaggacggtgcggtccaccgcctc
accgaggtggcgggcgtgcccgaggaacaggacctggtggtgcgcgccgcgcgcctgctg
caggctcacacgggcaccacgctcggcgtcgacatcgagatcgacaaggtgctgccgatg
ggcgcgggcctgggcggcggcagctccgacgcggccaccaccctgctcgccctgaaccgc
ctctggaatctcgacctgccgcgcgctgaacttcaggcgctggccgtgaaactgggcgcc
gacgtgcccttcttcgtgttcggaaaaaatgcgttcgcggagggtatcggagaggcactg
gagcaggtagaattgccggctcgctggttcctggttgtgacgcctcgagttcacgtaccg
accgctgaaattttttcagataagtcgttgacaagagattcgagacccatcacaattacg
gactttcttgcacagcaaagcagcaagggttggccagacagcttcggccaaaacgacatg
caggcggttgtgacaaagaagtacgcggaagttgcaaaggtagtcaaagcgttgtatgat
ttgaccccttcgcggatgaccggctctggagctagtgtcttcgcagcgttcggtagcaag
caggaggcgcaggcagcacaagccaccttgccgacaggctggaacagcgctgttaccgga
agcctgggtgaacatccactcttcgctttcgcgtcataa

DBGET integrated database retrieval system