KEGG   Burkholderia gladioli: bgla_1g35480Help
Entry
bgla_1g35480      CDS       T01464                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bgd  Burkholderia gladioli
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bgla_1g35480
   01230 Biosynthesis of amino acids
    bgla_1g35480
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bgla_1g35480
  Energy metabolism
   00680 Methane metabolism
    bgla_1g35480
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bgla_1g35480
Enzymes [BR:bgd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     bgla_1g35480
Exosome [BR:bgd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   bgla_1g35480
  Exosomal proteins of melanoma cells
   bgla_1g35480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:4023928..4024674
Genome map
AA seq 248 aa AA seqDB search
MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNNEARQAGVLLKEAGYAFDIAYTSVLKR
AIRTLWHVQDQMDQMYLPVVHSWRLNERHYGALSGLNKAETAAKFGDEQVLVWRRSYDTP
PPALEPSDERAPFDDPRYAKVPREQLPLTECLKDTVARVLPLWNESIAPAVKAGKQVLIA
AHGNSLRALIKYLDGISDEDIVGLNIPNGVPLVYELDENLKPIRHYYLGDQEAIAKAQAA
VAQQGKAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagctcgttctcatccgccacggcgaatcgacctggaacaaggaaaaccgcttc
accggctgggtcgacgtcgacctgaccgagcaaggcaacaacgaggcccgacaggccggc
gtcctgctcaaggaagccggctacgcgttcgacatcgcctacacctcggtgctcaagcgc
gcgatccgcacgctctggcacgtgcaggaccagatggaccagatgtacctgccggtggtg
cactcgtggcgcctcaacgagcgccactacggcgcgctgtcgggcctcaacaaggccgag
acggccgccaagttcggtgacgagcaggtgctggtgtggcgccgcagctacgacacgccg
ccgccggcgctggagccgagcgacgagcgcgcgcccttcgacgacccgcgctacgccaag
gtgccgcgcgagcagctgccgctcaccgaatgcctgaaggacaccgtggcgcgcgtgctg
ccgctgtggaacgagtcgatcgcgcccgccgtcaaggccggcaagcaggtgctgatcgcc
gcgcacggcaattcgctgcgcgcgttgatcaagtacctggacggcatctcggacgaggac
atcgtcggcctgaacatccccaacggcgtgccgctcgtctatgaactcgacgagaacctg
aagccgatccgccattactacctgggcgaccaggaggcgatcgccaaggcccaggccgcc
gtcgcgcagcagggcaaggccaagtaa

DBGET integrated database retrieval system