KEGG   Burkholderia gladioli: bgla_2g01190Help
Entry
bgla_2g01190      CDS       T01464                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bgd  Burkholderia gladioli
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    bgla_2g01190
Enzymes [BR:bgd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     bgla_2g01190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(134498..135160)
Genome map
AA seq 220 aa AA seqDB search
MSKRKTAGKAAAEPVAGKTTQIVERPSRAEAEDAVRVLLRWAGDDPAREGLLDTPARVAR
AYEEFFKGYQLEPKDILARTFSEVEGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPN
HRVVGISKLARLVDAFAKRLQIQEKMTVQIADTLFEVLQPKGVGVILEAAHQCISTRGIH
KPGVEMVTSRMLGTFRTDPSTRREFLSIVSNPSSVNLTNT
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacgcaagaccgccggcaaggcggcagccgagcccgtggccggcaagaccact
cagatcgtcgagcgcccgagccgcgccgaagccgaggacgccgtgcgcgtcctgctgcgc
tgggccggcgacgatcccgcccgcgagggcctgctcgacacgcccgcgcgcgtggcgcgc
gcctacgaggaattcttcaagggctaccagctcgagccgaaggacatcctcgcgcgcacc
ttcagcgaggtggaaggctacgacgagatgatcgtgctgaaggacatccgcttcgagagc
tattgcgagcaccacatggtgccgatcatcgggcgcgcgcacgtggcctacttgccgaac
caccgcgtggtcggcatctcgaagctggcgcggctggtggacgctttcgccaagcgcctg
cagatccaggaaaagatgacggtgcagatcgccgacacgctgttcgaggtgctgcagccc
aagggcgtgggcgtgatcctcgaagccgcccaccagtgcatctccacgcgcggcatccac
aagcccggcgtcgagatggtcacctcgcgcatgctcggcaccttccgcaccgatccgtcc
acgcgtcgcgaattcctctcgatcgtgtcgaatccgtcctcggtcaacctgacgaacacg
tga

DBGET integrated database retrieval system