KEGG   Burkholderia gladioli: bgla_2g03160Help
Entry
bgla_2g03160      CDS       T01464                                 

Definition
hypothetical protein
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bgd  Burkholderia gladioli
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    bgla_2g03160
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    bgla_2g03160
   00650 Butanoate metabolism
    bgla_2g03160
  Amino acid metabolism
   00360 Phenylalanine metabolism
    bgla_2g03160
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    bgla_2g03160
   00622 Xylene degradation
    bgla_2g03160
   00621 Dioxin degradation
    bgla_2g03160
Enzymes [BR:bgd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     bgla_2g03160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:409665..410558
Genome map
AA seq 297 aa AA seqDB search
MKQRTPRTRVAILGSGSIGIDLMFKVKACEQFELAWVVGRNADSDGLRLARECGVATSSD
GLDFMKDQVDGYDLVFDATSAAAHTIHNRFFAEAGKFAIDLTPAKLGRLCVPCINLPDTQ
AVQNVNLITCGGQASLPLAWALRQAVDSIDYLEVVSAIASRSAGMATRENISEYQATTEY
ALAKFSGAKRTKAILNINPAEPGIRMQTTLYAQARYRDFERVRERVEAMAARVREYVPGY
QLVVAPLESQGRITMSLTVRGRGDYLPEYAGNLDIINCAALAVATHRHATLSTGVPS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcgaaccccacgcacccgcgtcgccatcctcggctcgggcagcatcggcatc
gacctgatgttcaaggtgaaggcgtgcgagcagttcgagctggcctgggtggtcggccgc
aacgccgacagcgacggcctgcgcctggcgcgcgaatgcggcgtcgccacctcgagcgac
gggctcgatttcatgaaggaccaggtcgacggctacgacctggtgttcgacgccacctcg
gccgcggcccacacgatccacaaccgcttcttcgccgaagccggcaagttcgcgatcgac
ctcacgccggccaagctcgggcggctctgcgtgccctgcatcaacctgcccgacacgcag
gcggtgcagaacgtcaacctgatcacctgcggcgggcaggccagcctgccgttggcctgg
gcgctgcgccaggcggtcgattcgatcgactacctggaggtggtgtcggcgatcgcctcg
cgcagcgccggcatggccacccgcgagaacatcagcgagtaccaggccaccaccgagtac
gcgctggcgaagttcagcggcgccaagcgcaccaaggcgatcctcaacatcaacccggcc
gagcccggcatccgcatgcagaccacgctctatgcgcaggcgcgctaccgggatttcgag
cgggtgcgcgagcgcgtcgaggcgatggcggcccgggtgcgcgaatacgtgccgggctac
cagctggtggtggcgccgctcgagagccaggggcgcatcaccatgagcctgaccgtgcgc
ggacgcggcgactacctgcccgaatacgccggcaatctcgacatcatcaactgcgcggcg
ctggcggtggccacgcatcggcatgcaaccctcagcacgggagtcccatcatga

DBGET integrated database retrieval system