KEGG   Burkholderia gladioli: bgla_2g03160Help
Entry
bgla_2g03160      CDS       T01464                                 

Definition
hypothetical protein
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bgd  Burkholderia gladioli
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bgd00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bgd00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:bgd00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:bgd00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:bgd00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:409665..410558
Genome map
AA seq 297 aa AA seqDB search
MKQRTPRTRVAILGSGSIGIDLMFKVKACEQFELAWVVGRNADSDGLRLARECGVATSSD
GLDFMKDQVDGYDLVFDATSAAAHTIHNRFFAEAGKFAIDLTPAKLGRLCVPCINLPDTQ
AVQNVNLITCGGQASLPLAWALRQAVDSIDYLEVVSAIASRSAGMATRENISEYQATTEY
ALAKFSGAKRTKAILNINPAEPGIRMQTTLYAQARYRDFERVRERVEAMAARVREYVPGY
QLVVAPLESQGRITMSLTVRGRGDYLPEYAGNLDIINCAALAVATHRHATLSTGVPS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcgaaccccacgcacccgcgtcgccatcctcggctcgggcagcatcggcatc
gacctgatgttcaaggtgaaggcgtgcgagcagttcgagctggcctgggtggtcggccgc
aacgccgacagcgacggcctgcgcctggcgcgcgaatgcggcgtcgccacctcgagcgac
gggctcgatttcatgaaggaccaggtcgacggctacgacctggtgttcgacgccacctcg
gccgcggcccacacgatccacaaccgcttcttcgccgaagccggcaagttcgcgatcgac
ctcacgccggccaagctcgggcggctctgcgtgccctgcatcaacctgcccgacacgcag
gcggtgcagaacgtcaacctgatcacctgcggcgggcaggccagcctgccgttggcctgg
gcgctgcgccaggcggtcgattcgatcgactacctggaggtggtgtcggcgatcgcctcg
cgcagcgccggcatggccacccgcgagaacatcagcgagtaccaggccaccaccgagtac
gcgctggcgaagttcagcggcgccaagcgcaccaaggcgatcctcaacatcaacccggcc
gagcccggcatccgcatgcagaccacgctctatgcgcaggcgcgctaccgggatttcgag
cgggtgcgcgagcgcgtcgaggcgatggcggcccgggtgcgcgaatacgtgccgggctac
cagctggtggtggcgccgctcgagagccaggggcgcatcaccatgagcctgaccgtgcgc
ggacgcggcgactacctgcccgaatacgccggcaatctcgacatcatcaactgcgcggcg
ctggcggtggccacgcatcggcatgcaaccctcagcacgggagtcccatcatga

DBGET integrated database retrieval system