KEGG   Burkholderia gladioli: bgla_2g05980Help
Entry
bgla_2g05980      CDS       T01464                                 

Definition
1-phosphofructokinase
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
bgd  Burkholderia gladioli
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    bgla_2g05980
Enzymes [BR:bgd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     bgla_2g05980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:762680..763747
Genome map
AA seq 355 aa AA seqDB search
MSITIRSATNAARVVVTVTPNPALDQTVRVAGLALGAVNQAESLEINAGGKGVNVAGCLA
DYGIATIATGLLGREGSEAFETMFAGKRIDDRFVRIAGRTRTNVKLVDPARGQTTDINLA
TARATAQDLAALEARLASLMAPGRWFVLAGSLPPGVDTDFYRRATRSLHAAGARVALDTS
GAPLAAVLGSDDPRELPDLVKPNREELAAALGRPLDSREALLDAARELVARGVRHVAVSL
GEQGAFGLCTTGSAEFDGFHAAPLQVPVASTVGAGDAFVAGLVASLVEGRAWAEAGRRAS
AFAAAKLARVGPHLPDHATLDAHAARVELDTFTIAADGAARPRAGGAAAETSWKD
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcacgatccgatcggcgacaaacgccgcgcgcgtggtggtgaccgtcacgccg
aatcccgcgctcgaccagaccgtgcgcgtggccggcctcgcgctgggcgccgtgaaccag
gccgaatcgctcgagatcaacgcgggtggcaagggcgtcaacgtcgccggctgcctggcc
gactacggcatcgccacgatcgccacgggcctgctcggccgcgagggcagcgaggccttc
gagaccatgttcgccggcaagcgcatcgacgatcgtttcgtgcgcatcgccgggcgcacg
cgtaccaacgtcaaactggtcgatccagcgcgcggccagaccaccgatatcaatctcgcc
accgcgcgcgccacggcgcaggatttggcggcgctggaggcgcggctcgcctcgctgatg
gcgccggggcgctggttcgtgctggccggcagcctgccgcccggcgtcgacacggatttc
tatcgccgcgccacgcgctcgctgcacgcggcgggcgcgcgcgtcgcgctcgataccagt
ggcgcgccgctggccgccgtgctgggctcggacgatccacgcgagctgccggacctggtc
aagcccaatcgcgaggaactggcggcggcgctgggccggccgctggacagccgcgaggcc
ctgctcgacgcggcgcgcgagctggtggcgcgcggcgtacgccatgtcgccgtctcgctc
ggcgagcagggcgcattcggcctctgcacgaccggctcggccgaattcgacggttttcat
gcggcgcccttgcaggtgccggtggccagcacggtaggcgcgggcgacgccttcgtcgcc
gggctggtggcgagcctggtcgagggccgcgcgtgggccgaggccgggcgccgcgcgagc
gccttcgcggcggccaagctggcgcgcgtcggcccgcatctgccggatcacgcaacgctc
gacgcgcatgcggcgcgcgtcgaactcgacaccttcacgatcgcggccgacggcgccgcg
cgaccccgcgcgggcggcgcggcagcggagacatcatggaaagactga

DBGET integrated database retrieval system