KEGG   Burkholderia gladioli BSR3: bgla_2g06010Help
Entry
bgla_2g06010      CDS       T01464                                 

Definition
(GenBank) hypothetical protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00511  Other glycan degradation
bgd00520  Amino sugar and nucleotide sugar metabolism
bgd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    bgla_2g06010
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    bgla_2g06010
Enzymes [BR:bgd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     bgla_2g06010
Chaperones and folding catalysts [BR:bgd03110]
 Intramolecular chaperones
  Others
   bgla_2g06010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b
Motif
Other DBs
NCBI-ProteinID: AEA63077
UniProt: F2LIV1
Position
2:767576..769222
Genome map
AA seq 548 aa AA seqDB search
MRIPRSMTSWLSMLLAGGLVALGGQGAALAASGASRPAAAAPLACSEAELGQAPAGANGK
PMVIPTLRDWTGGNGTLSFDAGSRILVDPADAAALADTATQFQAQLKIVSGLALPIVSRA
ATPAAGDIVLSLAPCGASAAQLGEEGYSLDLEDHAVLRGRGAAGVFYATQTLLQMLSLDG
AAAGAHLRVTRGFAVDVPRYAERSIMFDVGRKYASVDFLAAYLRFMGWYKLNTLHLHLND
QAKAKDGSWGLRAFRLKSDKPEFAGLVPADGLVYTRDDWDKLETIAAAHHVRIVPEFDTP
GHAGAFAAANPAIAYVGDTPPGGTIDPTKPATLRYVESVFGEFLPWFRSSTVHIGGDEVN
VNSGSISTASQVDYLNQLGRFLQSRHRRVETWGDASYLPRLDKSFIIQRWINWGSEASIN
WADKGYQWTESYGDWYIVPFGPSYFNPDGIKGDTLYAKWSQATGANAPSGGQIAVWNDNA
LLDSYTWESKVNDLLKDAVPAAGQVFWRGQEHDAQGQALDYDVLRRSVATLQYGPDVTRF
SDSPIPAR
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattccgcgttcgatgacatcctggctgtcgatgctgctggccggcggtctggtc
gcgcttggcggccaaggcgcggcgcttgccgcatccggcgcgagccggccggcagcggcg
gccccgctggcctgcagcgaggccgagctgggacaggcgccggccggcgccaatggcaag
ccgatggtgattcccaccttgcgcgactggaccggcggcaacggcacgctgagcttcgat
gccggcagccggatcctggtcgacccggccgacgcggccgcgctcgcggataccgccacg
cagttccaggcgcaactgaagatcgtgtccggtctcgctcttccgatcgtgagccgggcc
gccacgccggccgccggggacatcgtgctgagcctcgcgccttgcggcgcgagcgccgcc
cagctcggcgaggaaggctacagcctcgatctggaggaccacgcggtgctgcgtggccga
ggcgcggcgggcgtgttctacgcgacgcagacgctgctgcagatgctctcgctggacggc
gccgccgcgggcgcgcatctgcgggtgacgcgtggcttcgcggtggacgtgccgcgctac
gcggagcgcagcatcatgttcgacgtcggccgcaagtacgcgagcgtcgatttcctcgcg
gcttacctgcgcttcatgggttggtacaagctcaacacgctgcacctgcacctgaacgac
caggccaaggcgaaggacggcagttggggtttgcgcgccttccgcctgaagagcgacaag
ccggaattcgccggcctggtgcccgccgatggcctggtctacacgcgcgacgactgggac
aagctggagacgatcgccgccgcccatcacgtgcggatcgtgccggaattcgacacgccg
gggcatgccggcgccttcgccgcggccaatcccgcgatcgcctatgtcggcgatacgccg
cccggcggcaccatcgacccgaccaagccggcaacgctgcggtacgtggagtcggtgttc
ggcgaattcctgccctggttccggtcctcgaccgtgcatatcggcggcgacgaggtcaat
gtcaactcgggcagcatcagcacggcgagccaggtcgactacctgaaccagctcggcagg
ttcctgcagtcgaggcacaggcgcgtcgagacgtggggcgacgcgagctacctgccgcgg
ctcgacaagtccttcatcatccagcgctggatcaactggggcagcgaggcctcgatcaac
tgggccgacaagggctaccagtggaccgaatcctacggcgactggtacatcgtgccgttc
ggcccgagctacttcaatccggacggcatcaagggcgacacgctgtacgccaaatggagc
caggccacgggcgccaacgcgccgagcggcggccagatcgccgtgtggaacgacaacgcg
ctgctggacagctatacctgggagagcaaggtgaacgacctgctcaaggatgcggtgccg
gccgccggccaggtgttctggcgcgggcaagagcatgacgcccagggccaagccctcgac
tacgacgtgctgcgccgctcggtggccacgctgcaatacgggcccgacgtcacgcgcttt
tccgactcgccgattccggccaggtag

DBGET integrated database retrieval system