KEGG   Burkholderia gladioli: bgla_2g06010Help
Entry
bgla_2g06010      CDS       T01464                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bgd  Burkholderia gladioli
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    bgla_2g06010
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    bgla_2g06010
Enzymes [BR:bgd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     bgla_2g06010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:767576..769222
Genome map
AA seq 548 aa AA seqDB search
MRIPRSMTSWLSMLLAGGLVALGGQGAALAASGASRPAAAAPLACSEAELGQAPAGANGK
PMVIPTLRDWTGGNGTLSFDAGSRILVDPADAAALADTATQFQAQLKIVSGLALPIVSRA
ATPAAGDIVLSLAPCGASAAQLGEEGYSLDLEDHAVLRGRGAAGVFYATQTLLQMLSLDG
AAAGAHLRVTRGFAVDVPRYAERSIMFDVGRKYASVDFLAAYLRFMGWYKLNTLHLHLND
QAKAKDGSWGLRAFRLKSDKPEFAGLVPADGLVYTRDDWDKLETIAAAHHVRIVPEFDTP
GHAGAFAAANPAIAYVGDTPPGGTIDPTKPATLRYVESVFGEFLPWFRSSTVHIGGDEVN
VNSGSISTASQVDYLNQLGRFLQSRHRRVETWGDASYLPRLDKSFIIQRWINWGSEASIN
WADKGYQWTESYGDWYIVPFGPSYFNPDGIKGDTLYAKWSQATGANAPSGGQIAVWNDNA
LLDSYTWESKVNDLLKDAVPAAGQVFWRGQEHDAQGQALDYDVLRRSVATLQYGPDVTRF
SDSPIPAR
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattccgcgttcgatgacatcctggctgtcgatgctgctggccggcggtctggtc
gcgcttggcggccaaggcgcggcgcttgccgcatccggcgcgagccggccggcagcggcg
gccccgctggcctgcagcgaggccgagctgggacaggcgccggccggcgccaatggcaag
ccgatggtgattcccaccttgcgcgactggaccggcggcaacggcacgctgagcttcgat
gccggcagccggatcctggtcgacccggccgacgcggccgcgctcgcggataccgccacg
cagttccaggcgcaactgaagatcgtgtccggtctcgctcttccgatcgtgagccgggcc
gccacgccggccgccggggacatcgtgctgagcctcgcgccttgcggcgcgagcgccgcc
cagctcggcgaggaaggctacagcctcgatctggaggaccacgcggtgctgcgtggccga
ggcgcggcgggcgtgttctacgcgacgcagacgctgctgcagatgctctcgctggacggc
gccgccgcgggcgcgcatctgcgggtgacgcgtggcttcgcggtggacgtgccgcgctac
gcggagcgcagcatcatgttcgacgtcggccgcaagtacgcgagcgtcgatttcctcgcg
gcttacctgcgcttcatgggttggtacaagctcaacacgctgcacctgcacctgaacgac
caggccaaggcgaaggacggcagttggggtttgcgcgccttccgcctgaagagcgacaag
ccggaattcgccggcctggtgcccgccgatggcctggtctacacgcgcgacgactgggac
aagctggagacgatcgccgccgcccatcacgtgcggatcgtgccggaattcgacacgccg
gggcatgccggcgccttcgccgcggccaatcccgcgatcgcctatgtcggcgatacgccg
cccggcggcaccatcgacccgaccaagccggcaacgctgcggtacgtggagtcggtgttc
ggcgaattcctgccctggttccggtcctcgaccgtgcatatcggcggcgacgaggtcaat
gtcaactcgggcagcatcagcacggcgagccaggtcgactacctgaaccagctcggcagg
ttcctgcagtcgaggcacaggcgcgtcgagacgtggggcgacgcgagctacctgccgcgg
ctcgacaagtccttcatcatccagcgctggatcaactggggcagcgaggcctcgatcaac
tgggccgacaagggctaccagtggaccgaatcctacggcgactggtacatcgtgccgttc
ggcccgagctacttcaatccggacggcatcaagggcgacacgctgtacgccaaatggagc
caggccacgggcgccaacgcgccgagcggcggccagatcgccgtgtggaacgacaacgcg
ctgctggacagctatacctgggagagcaaggtgaacgacctgctcaaggatgcggtgccg
gccgccggccaggtgttctggcgcgggcaagagcatgacgcccagggccaagccctcgac
tacgacgtgctgcgccgctcggtggccacgctgcaatacgggcccgacgtcacgcgcttt
tccgactcgccgattccggccaggtag

DBGET integrated database retrieval system