KEGG   Burkholderia gladioli: bgla_2g06500Help
Entry
bgla_2g06500      CDS       T01464                                 

Definition
glycoside hydrolase family protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bgd  Burkholderia gladioli
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    bgla_2g06500
Enzymes [BR:bgd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     bgla_2g06500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(820012..822018)
Genome map
AA seq 668 aa AA seqDB search
MHLGVCYYPEHWPEALWRDDAARMKALGIERVRIAEFAWSRIEPTPGEYDWGWLDRAIDT
LGAAGLQVVMCTPTATPPKWLIDLHPEILAIGADGRPRQFGSRRHYDFSSPVYLEASRRI
CEAVARRYGEHPAVAYWQTDNEYGCHHTVLSYSPAALARFRDWLRTRYGSIGALNAAWGT
VFWSMEYRGFEEIDAPVGTVTEAHPSHRLDYRRFASDEVRRYNRMQVELIRAHSPGRPIA
HNFMQLFTEFDHYPVAADLDIAAWDSYPLGALEEQWYAPAVKARYLRTGHPDFASFNHDL
YRGMSKLPFWVMEQQPGPVNWAQWNPSPLPGMVRLWSWEAFAHGAGCVSYFRWRQAPFAQ
EQMHAGLNTPDNRLDLGGKEAAVVAEELRALRADRDADASGPVRARVALVFDYTAKWLFE
IHPQGADFHYPRFAVEYYSALRSLGLDVDIVPADAPLDGYRLVVVPPLPILPDDFAARLA
ASGAQVVLGPRSGSKTAELRIPAELPPGPLASILPIRVWRVESLRPNLAEPVQLAATEHE
AAHRGEAHHWRDLVEAGHAATEIRARFEDGHPAWLRHGSLHYLASLFDEATTAALFARIA
REAGLEPVALGDAVRVSRRGKLTWVFNYGPGTHTLDAAIPDAAIVIGTRHIEAAGVAAYR
SPEHDAKQ
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgcatcttggcgtctgctactaccccgagcactggcccgaagccctctggcgcgacgac
gccgcgcgcatgaaggcgctcggcatcgagcgcgtgcgcatcgccgaattcgcctggagc
cggatcgagcccacgcccggcgaatacgactggggctggctcgatcgcgcgatcgacacg
ctcggcgcggcgggcctgcaggtggtgatgtgcacgcccaccgcgacgccgccgaaatgg
ctgatcgaccttcatcccgagatcctcgcgatcggcgccgacggccggccgcgccagttc
ggctcgcggcgccactacgatttctcctcgcccgtttatctcgaagcctcacgacgcatc
tgcgaggcggtcgcgcggcgctacggcgaacatccggccgtcgcctactggcagaccgac
aacgaatacggctgccaccacacggtgctcagctactcgccggccgcgctggcgcgtttc
cgcgactggctgcgcacgcgctacggcagcatcggcgcgctcaacgcggcctggggcacg
gtgttctggagcatggagtatcgcggcttcgaggagatcgacgcgccggtcggcaccgtc
accgaggcgcatccctcgcatcggctcgactaccgccgcttcgcctcggacgaggtgcgc
cgctacaaccgcatgcaggtcgagctgatccgcgcgcattcgccgggacggccgatcgcg
cacaacttcatgcaactgttcaccgagttcgaccactacccggtggcggccgatctcgac
atcgccgcctgggacagctacccgctcggcgcgctcgaggagcagtggtacgcgccggcg
gtgaaggcgcgctacctgcgcaccggccatcccgatttcgccagcttcaaccacgatctc
taccgcggcatgtcgaagctgccgttctgggtgatggagcagcagccggggccggtcaac
tgggcgcaatggaacccctcgccgctgccgggcatggtgcgcctgtggagctgggaagcc
ttcgcgcacggcgccggctgcgtgtcctacttccgctggcgccaggcgccgttcgcgcag
gagcagatgcatgccgggctgaacacgccggacaaccggctcgatctcggcggcaaggag
gccgccgtcgtcgccgaggaactgcgcgcgctgcgggccgatcgcgacgccgacgcgagc
ggcccggtacgtgcccgcgtcgcgctggtgttcgactacaccgcgaaatggctgttcgag
atccatccgcaaggcgccgacttccactatccgcgcttcgccgtcgagtactactcggcg
ctgcgctcgctcggcctcgacgtcgacatcgtgccggccgacgcgccgctcgacggctat
cgcctggtggtggtgccgccgctgccgatcctgcccgacgacttcgccgcgcggctggcc
gccagcggcgcgcaggtggtgctgggcccgcgcagcggctcgaagacggccgagctgcgg
attcccgccgaattgccgcccggcccgctggcctcgatcctgccgatccgcgtatggcgc
gtggaatcgctgcggccgaacctggccgagccggtacaactcgccgcgaccgaacacgag
gccgcgcaccggggcgaggcccatcactggcgcgacctggtcgaggccgggcacgccgcc
accgagattcgcgcgcgcttcgaggacggccacccggcctggctgcgccacggctcgctg
cactatctcgcgagcctgttcgacgaggccaccacggccgcgctgttcgcccgcatcgcc
cgcgaagccggcctcgagccggtcgcgctcggcgacgcggtgcgcgtcagccggcgcggc
aagctcacctgggtcttcaactacggcccgggtacccacacgctcgacgccgccattccc
gatgcggcgatcgtgatcggcacgcggcacatcgaggcggccggcgtcgccgcttatcgc
tcgccagagcacgacgccaagcaataa

DBGET integrated database retrieval system