KEGG   Burkholderia gladioli: bgla_2g07570Help
Entry
bgla_2g07570      CDS       T01464                                 

Definition
threonine dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bgd  Burkholderia gladioli
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bgla_2g07570
  Energy metabolism
   00680 Methane metabolism
    bgla_2g07570
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    bgla_2g07570
Enzymes [BR:bgd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     bgla_2g07570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:947383..948579
Genome map
AA seq 398 aa AA seqDB search
MSSNRGVVYQGPGQVEVQKIDYPRMVDPSGRKIGHGVILKVVSTNICGSDQHMVRGRTTA
PVGLVLGHEITGEVIELGSDVETLKIGDIVTVPFNVACGRCPMCREQSTGVCLNVNPARA
GGAYGYVDMGGWIGGQAEYVLVPYADFNLIKFPDRDQAMAKIRDLTCLSDILPTGYHGAV
TAGVKPGSTVYIAGVGPVGMAAAASARLLGAAVTIVGDMNAERLAHARKVGFETVDLSKD
TPLGEQIAAIVGRPEIDCAVDCVGFEAHGHGSSGHAEEAPATVLNSLMEITRPAGAIGIP
GLYVTDDPGAKDAAAKHGSLSIRFGLGWAKSHTFHTGQTPVLKYNRNLMQAILFDRLPIA
EIVNVTVISLDQAPEGYRKFDGGAPRKFVIDPHGLIAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaatcgaggagtcgtgtatcagggcccgggccaggtcgaggtgcagaagatc
gactatccgcggatggtcgatccgagcggtcgcaagatcggccatggcgtgatcctgaag
gtggtgagcacgaacatctgcggctccgaccagcacatggtgcgcggccggaccacggcg
ccggtcggtctggtgctcggccacgagatcaccggcgaggtgatcgagctgggcagcgac
gtggagacgctcaagatcggcgacatcgtcacggtgccgttcaacgtggcctgcgggcgc
tgcccgatgtgccgcgaacagagcacgggcgtgtgcctgaacgtcaatccggcgcgcgcc
ggcggcgcctatggttatgtcgacatgggcggctggatcggcggccaggccgaatacgtg
ctggtgccctatgccgacttcaacctgatcaagttcccggatcgcgaccaggcgatggcg
aagatccgcgacctgacctgcctgtccgacatcctgcccaccggttatcacggcgccgtc
acggccggcgtgaagccgggctcgaccgtctatatcgccggcgtgggcccggtggggatg
gcggcggccgcctcggcgcgcctgctcggcgcggcggtgacgatcgtcggcgacatgaac
gccgagcgtctcgcgcacgcgcgcaaggtcggtttcgaaaccgtcgacctgtccaaggac
acgccgctcggcgagcagatcgcggcgatcgtcggccgccccgagatcgattgcgcggtg
gactgcgtgggcttcgaggcgcacggccacggctcgtccggccatgccgaggaggcaccc
gccacggtgctgaactcgctgatggagatcacgcggccggccggcgcgatcggcatcccg
ggcctctacgtgacggacgatccgggcgcgaaggacgccgccgccaagcacggcagcctg
agcatccgcttcggcctgggctgggccaagtcgcataccttccacacgggccagacgccg
gtgctgaagtacaaccgcaacctgatgcaggcaatcctgttcgaccgcctgccgatcgcc
gagatcgtcaacgtcacggtgatctcgctcgaccaggcgccggaaggctatcgcaagttc
gatggcggcgcgccgcgcaagttcgtgatcgacccgcatgggctgatcgcggcctga

DBGET integrated database retrieval system