KEGG   Burkholderia gladioli: bgla_2g07940Help
Entry
bgla_2g07940      CDS       T01464                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bgd  Burkholderia gladioli
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    bgla_2g07940
   00052 Galactose metabolism
    bgla_2g07940
   00500 Starch and sucrose metabolism
    bgla_2g07940
   00520 Amino sugar and nucleotide sugar metabolism
    bgla_2g07940
Enzymes [BR:bgd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     bgla_2g07940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(992873..993757)
Genome map
AA seq 294 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLVQYAVEEAINAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLSLVRSIKPSHVDCFYVRQAEALGLGHAVLCAEK
LVGNQPFAVMLADDLLDGPTPVLRQMIDVFDHYHASVIGVEEIAPEASSSYGVIEGKRWE
DNLFKLSGIVEKPEPAKAPSNLGVVGRYVLKPKVFEHLRALRPGSGGELQLTDAIQSLLA
HEQVLAHRYEGTRFDCGSKLGYLKATVEFALRHPELAADFEDYLAARMALQPAV
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtgacaaaagccgtatttccggtcgccggcctcggcacgcgattcctgccc
gccaccaaggccagcccgaaggaaatgctgccggtcgtggacaagccgctggttcaatat
gcggtcgaggaagcgatcaacgcgggtatcacggagatgattttcgtgaccggtcgcagc
aagcgcgccatcgaggatcacttcgacaaatcctacgaaatcgaggcggagctcgaagcg
cgcgggaaggaaaagctgctgtcgctggttcgcagcatcaagccgagtcatgtcgattgc
ttctacgtgcgccaggcggaggcattgggactcggtcatgcggtgctgtgcgcggagaag
ctggtcggcaaccaacccttcgcggtcatgctggccgacgacctcctcgacggccccaca
cccgtattgcgccagatgatcgacgtgttcgatcactatcacgcgtcggtaatcggcgtg
gaggaaatcgcgcccgaggcatcgagctcgtacggtgtgatcgagggcaagcgctgggag
gacaacctgttcaagctgtcggggatcgtcgagaagccggagccggccaaggcaccgtcc
aatctgggcgtggtgggccgctacgtactgaagccgaaggtgttcgagcatctacgcgcg
ctgcggcccggttccggcggcgaactgcaattgaccgacgcgatccagtccctgctcgcc
cacgagcaggtactcgcccaccgctacgaaggaacgcgcttcgattgcggcagcaagctc
ggatacctgaaggcgacggtcgagttcgcgctgcggcaccccgaattggctgcggatttc
gaagactatctcgccgcgcggatggcgctgcaaccggccgtttaa

DBGET integrated database retrieval system