KEGG   Burkholderia gladioli: bgla_2g09270Help
Entry
bgla_2g09270      CDS       T01464                                 

Definition
Pyridoxal-5'-phosphate-dependent protein beta subunit
Organism
bgd  Burkholderia gladioli
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1156883..1157923
Genome map
AA seq 346 aa AA seqDB search
MDTIEIKGSRFPRFALLDAVTPIQRLARLEAELGERLNGVQLYAKRDDHVALGGGGNKLR
KLELHLGQALAEGVDTLITVGGIQSNHARQTAAAAALAGLRCELVLARMVPREGVDYERN
GNVLLDELFGATLHVAPAGTSALDLAQARAAELRRAGRKVLVIPSGGSTGLGALGYAACA
AEIDAQARELGIEFACVACPNGSAGTHAGLVAGFHALGRDPGLVRAYGVLAPADEAAAMT
VKLVDEACALLGIAPPPAGTIGVEGAHRGEGYGIPTEGMLAAVRLMARSQGLLLDPVYSG
KAFAGLLADIEAGRFRRGDKLLFLMTGGAPALYAYRGIFEETRGQA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggacaccatcgaaatcaagggcagccgcttcccgcgcttcgcgctgctcgacgccgtc
acgccgatccagcggctcgcgcggctggaagccgaactcggcgagcgcctgaacggcgtg
cagctttatgcgaagcgcgacgaccacgtcgcgctcggcggcggcggcaacaagctgcgc
aagctcgaactgcacctggggcaggcgctggccgagggcgtcgacacgctgatcacggtc
ggcgggatccagtcgaatcacgcgcggcagaccgcggcggccgcggcgctggccgggctg
cgttgcgaactggtgctggcgcgcatggtgccgcgcgagggcgtcgactacgagcgcaac
ggcaacgtgctgctcgacgagctgttcggcgcgacactccacgtcgcgccggcgggcacg
tcggcactcgatctggcccaggcgcgcgccgcggaactgcgccgcgcgggccgcaaggtg
ctggtgattccctcgggcggctccaccggcctgggcgcgctcggttatgccgcctgcgcc
gccgagatcgacgcgcaggcgcgcgagctcggcatcgagttcgcctgcgtggcttgcccg
aacggcagcgccggcacgcatgcggggctggtggccggctttcacgcgctgggccgcgac
cctggcctggtgcgcgcctacggcgtgctggcgccggccgacgaggccgccgcgatgacc
gtgaagctggtcgacgaagcctgcgcgctgctcggcatcgcgccgccgccggccggcacg
atcggcgtggagggcgcgcatcgcggcgagggttacggcattcccaccgagggcatgctg
gcggccgtgcgcctgatggcgcgcagccaggggctgctgctcgatcccgtgtacagcggc
aaggccttcgccgggctgctggccgatatcgaggccgggcgcttccggcgcggcgacaag
ctgctgttcctgatgacgggtggcgcgccggcgctgtatgcctaccgcggcatcttcgag
gaaacgcgcggccaggcctga

DBGET integrated database retrieval system