KEGG   Burkholderia gladioli BSR3: bgla_2g09270Help
Entry
bgla_2g09270      CDS       T01464                                 

Definition
(RefSeq) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    bgla_2g09270
Enzymes [BR:bgd01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     bgla_2g09270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1156883..1157923
Genome map
AA seq 346 aa AA seqDB search
MDTIEIKGSRFPRFALLDAVTPIQRLARLEAELGERLNGVQLYAKRDDHVALGGGGNKLR
KLELHLGQALAEGVDTLITVGGIQSNHARQTAAAAALAGLRCELVLARMVPREGVDYERN
GNVLLDELFGATLHVAPAGTSALDLAQARAAELRRAGRKVLVIPSGGSTGLGALGYAACA
AEIDAQARELGIEFACVACPNGSAGTHAGLVAGFHALGRDPGLVRAYGVLAPADEAAAMT
VKLVDEACALLGIAPPPAGTIGVEGAHRGEGYGIPTEGMLAAVRLMARSQGLLLDPVYSG
KAFAGLLADIEAGRFRRGDKLLFLMTGGAPALYAYRGIFEETRGQA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggacaccatcgaaatcaagggcagccgcttcccgcgcttcgcgctgctcgacgccgtc
acgccgatccagcggctcgcgcggctggaagccgaactcggcgagcgcctgaacggcgtg
cagctttatgcgaagcgcgacgaccacgtcgcgctcggcggcggcggcaacaagctgcgc
aagctcgaactgcacctggggcaggcgctggccgagggcgtcgacacgctgatcacggtc
ggcgggatccagtcgaatcacgcgcggcagaccgcggcggccgcggcgctggccgggctg
cgttgcgaactggtgctggcgcgcatggtgccgcgcgagggcgtcgactacgagcgcaac
ggcaacgtgctgctcgacgagctgttcggcgcgacactccacgtcgcgccggcgggcacg
tcggcactcgatctggcccaggcgcgcgccgcggaactgcgccgcgcgggccgcaaggtg
ctggtgattccctcgggcggctccaccggcctgggcgcgctcggttatgccgcctgcgcc
gccgagatcgacgcgcaggcgcgcgagctcggcatcgagttcgcctgcgtggcttgcccg
aacggcagcgccggcacgcatgcggggctggtggccggctttcacgcgctgggccgcgac
cctggcctggtgcgcgcctacggcgtgctggcgccggccgacgaggccgccgcgatgacc
gtgaagctggtcgacgaagcctgcgcgctgctcggcatcgcgccgccgccggccggcacg
atcggcgtggagggcgcgcatcgcggcgagggttacggcattcccaccgagggcatgctg
gcggccgtgcgcctgatggcgcgcagccaggggctgctgctcgatcccgtgtacagcggc
aaggccttcgccgggctgctggccgatatcgaggccgggcgcttccggcgcggcgacaag
ctgctgttcctgatgacgggtggcgcgccggcgctgtatgcctaccgcggcatcttcgag
gaaacgcgcggccaggcctga

DBGET integrated database retrieval system