KEGG   Burkholderia gladioli: bgla_2g09320Help
Entry
bgla_2g09320      CDS       T01464                                 

Definition
putative glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bgd  Burkholderia gladioli
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    bgla_2g09320
Enzymes [BR:bgd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     bgla_2g09320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1166239..1168635)
Genome map
AA seq 798 aa AA seqDB search
MSAAQASSIAALARAAGLEPDWTDAGGTARRVDDAALAVLLDALGLPCATRADREWSSAA
LHAPAAAPPLVTADVGTPVPWPGGHDRVGDSYTLRLESGESSQGKLLADAGGAGSGPGLL
LPPIATPGYHQVETAATSLTVAVAPARGWTLDDAAHAAGRARPFGLAAQLYGLRRDGDLG
LGDTSALATLARSAARLGADALALSPTHAGFPAQPERDSPYSPSSRRWHNLAYVDPDMVL
GAEATRAVLAETGLADTAEALSRAPLVDWPRALHLKLRVLRALFERWRAHPSAEHEAFAR
FSTEGGDALHAQAVFDALQAQAIAERLGPDWRRWPAEWQSPGTTEVRAFAAAHAEHVAFF
AFTQWLASRGLDGARQAAREAGMSIGTIADLAVGVAPDGADAWAAPHTLLSGLSIGAPPD
LFNPEGQAWGVATWTPAGLRANGYAPFIALLRGAFAHAGGVRIDHILGFQRLWIVRDGGS
PREGAYLRYPLDDLLRLVALESARHRAIAIGEDLGTVPEGLRERLAARGIAGMRVLAFER
ERDGAFRPPEAWDRDAAAMSSTHDLPTLAGWWRGVDLAWRRHVLAGQDRRADEGGPAREA
GEAAAASAAFADAMQPDDPEATWPPMENRMIDRASSLAPALREHAPSPTRPVARDAEVPR
DAVEAAGASGACAAPTTSAAPLPPDLAAREADRAQLWQALLAAGVVPPNTASQAPPTADA
PPVAAALAFVARSASTLALLPLEDLLALPAQPNLPGPPVGHPNWRRRMPRDTARLIDDPA
AAALAAIALARRTAGEPR
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgcgcaagcctcctcgatcgcggcgctggcgcgcgcggccggcctcgagccg
gactggaccgatgccggcggcaccgcgcggcgcgtcgacgacgcggcgctggcggtgctg
ctcgatgcgctcgggctgccctgcgcgacgcgtgccgatcgcgaatggagcagcgccgcg
ctgcacgcgccggccgccgcgccgccgctcgtgacggccgacgtgggcacgccggtgccc
tggcccggcgggcacgaccgcgtcggcgacagctacacgctgaggctggagagcggcgaa
tccagccagggcaagctgcttgccgatgctggcggcgcaggttccggccccggccttctg
ctgccgccgatcgcgacgcccggctaccaccaggtcgagaccgccgcgacgagcctcacc
gtcgccgtcgcgccggcgcgcggctggaccctcgacgacgccgcgcacgcggccggccgc
gcgcgcccgttcggcctggcggcccagctctacggcctgcgccgcgacggcgacctgggc
ctgggcgacaccagcgcgctggccaccctggcgcgctcggccgcgaggctgggcgccgac
gcgctggcgctgagcccgacccacgccggcttcccggcccagcccgagcgcgacagcccc
tattcgccctcctcgcggcgctggcacaacctcgcctatgtcgatcccgacatggtgctg
ggcgccgaggcgacgcgcgccgtgctggccgaaaccgggctcgccgacaccgccgaggcg
ctgtcgcgcgcgccgctggtcgactggccgcgcgcgcttcatctcaagctgcgcgtgctg
cgtgccctgttcgagcgctggcgcgcccatccctcggccgaacacgaggccttcgcgcgc
ttctcgaccgaaggcggcgacgcgctgcacgcgcaagccgtgttcgacgccctgcaggcg
caggccatcgccgagcggctcggccccgactggcgccgctggcccgcagagtggcagagc
cccggcaccaccgaggtacgcgccttcgcggccgcgcacgccgagcacgtcgccttcttc
gccttcacgcaatggctggcctcgcgcgggctggacggcgcgcgccaggccgcgcgagag
gccggcatgtcgatcggcacgatcgccgatctcgcggtcggcgtggcgcccgacggcgcc
gatgcctgggccgcgccgcacacgctgctctcggggctgtcgatcggcgcgccgcccgac
ctgttcaatcccgagggccaggcctggggcgtcgccacctggaccccggccggcctgcgc
gcgaacggctacgcgcccttcatcgcgctgctgcgcggcgccttcgcgcatgccggcggc
gtgcgcatcgatcacatcctcggcttccagcggctgtggatcgtgcgcgacggcggctcg
ccgcgcgagggcgcctacctgcgctacccgctcgacgacctgctgcggctggtcgcgctc
gaatccgcgcggcatcgcgccatcgcgatcggcgaggatctcggcaccgtgcccgagggc
ttgcgcgaacggctggccgcgcgcggcatcgccgggatgcgcgtgctcgccttcgagcgc
gaacgcgacggcgcgttccggccgcccgaggcctgggaccgcgacgcggcggcgatgtcc
tccacgcacgacctgccgacgctggccggctggtggcgcggcgtcgacctggcctggcgc
cggcatgtgctggccgggcaggaccggcgcgccgacgagggcgggccggcgcgcgaggcc
ggtgaggccgcggcggcaagcgccgcgttcgccgacgcgatgcagcccgatgatcccgag
gcaacctggccccccatggagaaccgcatgatcgatagggcttcgtctctcgcccccgct
ttgcgggaacacgcgccctcgccgacgcggccggtggcgcgcgatgccgaagtgccgcgc
gatgcagtggaggcggccggcgcttccggggcttgcgccgcaccgaccacctccgccgcg
ccgctgccgcccgatctcgccgcacgcgaagcggatcgcgcccagctctggcaggcgctg
ctggcggccggcgtggtgccgcccaacacggcctcccaggcaccgccgacggccgacgcg
ccgcccgtggcagcggcgctggccttcgtcgcgcgcagcgcctcgacgctcgccctgctg
ccgctcgaggacctgctggccctgcccgcccaaccgaacctgccgggcccgccggtcggc
catccgaactggcgccgccgcatgccgcgcgacacggcgcggctgatcgacgatcccgcc
gcggccgcgctggcggccatcgcgctcgcgcgccgcaccgcgggagagccgcgatga

DBGET integrated database retrieval system