KEGG   Burkholderia gladioli: bgla_2g09350Help
Entry
bgla_2g09350      CDS       T01464                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bgd  Burkholderia gladioli
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    bgla_2g09350
Enzymes [BR:bgd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     bgla_2g09350
Exosome [BR:bgd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   bgla_2g09350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1173269..1175467)
Genome map
AA seq 732 aa AA seqDB search
MSDTLFDPSDIDALLDARHPDPFACLGKHRLGERTVVRALLPGAHRVHAVAREGGRVLGE
LERVAPAGCFAGTLEDDADYRLSIDWMTVTQEVEDIYAFGPLLAEDRLARLAEGDPLAVL
DCLGARPMSVDGVPGVRFALWAPSAARVSVVGDFNSWDGRRNPMRLRRPWGVWELFVPRI
GAGVRYKFELRTREGVVLPLKADPCARATEAPPLTASVVADAEALSSFEWHDQDWMRRRA
ETDAERAPMSVYEVHPESWQRLGDPPRAPSWDELADRLIPYAAGMGFTHIELMPVAEYPF
GGSWGYQPLSPFAPSARFGPVEGFSRFVDRAHAAGLGVIVDWVAAHFPTDPHGLGQFDGT
ALYEHADPREGFHPDWNTLVFNLGRHEVRGFLIAAALAWVRDHHVDGLRVDAVASMLYRD
YSRASGEWVPNVHGGRENLESIAFLRGLNDTLHGPLAPPGVLSIAEESTAWPGVTAPTAH
GGLGFDFKWNMGWMHDTLSYLGEDPIHRRHHHDRIGFGLVYAFSERFVLPLSHDEVVHGK
GSLLAKVPGDAWQRFATLRAYYGFMWAHPGKKLLFMGGEFAQPGEFSHDGQPPWDLLDAP
AHRGVQRLVRDLNRLSADEPALYRLDSRPEGFGWLVGDDASNSVYAFQRRDDSGRVLVAI
CNFTPVPREGYRVGLPAGGRWIELLNTDSAAYGGTNSGNGGAVQAQDVPAHGQSWSAELR
LPPLATLWLRPD
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacacgctgttcgacccgtccgatatcgatgcgctgctggacgcgcgccacccg
gacccgttcgcctgcctcggcaagcatcgcctcggcgagcgcaccgtggtgcgcgccctg
ctgcccggcgcgcatcgcgtgcacgcggtggcgcgcgagggcggccgcgtgctcggcgag
ctggagcgcgtggcgccggccggctgcttcgccggcacgctggaggacgacgccgattac
cggctctcgatcgactggatgaccgtgacccaggaggtcgaggacatctatgccttcggc
ccgctgctggccgaggaccggctcgcgcgcctggccgagggcgacccgctggccgtgctc
gactgcctcggcgcgcggccgatgagcgtggacggcgtgcccggcgtgcgcttcgcgctg
tgggcgccgagcgccgcgcgggtctcggtggtcggcgatttcaattcatgggacgggcgc
cgcaacccgatgcggctgcgccgcccctggggcgtgtgggagctgttcgtgccgcgcatc
ggcgccggcgtgcgctacaagttcgagctgcgcacgcgcgagggcgtggtgctgccgctc
aaggccgatccttgcgcgcgcgccaccgaggcgccgccgctgacggcctcggtggtggcc
gacgccgaggcgctgtcgagcttcgaatggcacgaccaggactggatgcgccgccgcgcc
gaaaccgatgccgagcgcgcgccgatgtcggtctacgaggtccatccggaatcctggcaa
aggctcggcgatccgccgcgcgcaccgagctgggacgagctggccgaccggctgatcccc
tacgcggccggcatgggcttcacccacatcgagctgatgccggtggccgagtacccgttc
ggcggctcctggggctaccagccgctctcaccgttcgcgccctcggcgcgcttcgggccg
gtggagggcttctcgcgcttcgtcgaccgcgcgcacgcggccggcctcggcgtgatcgtc
gactgggtggccgcgcattttccgaccgacccgcacgggctcggccagttcgacggcacc
gcgctctacgagcacgccgatccgcgcgagggtttccatcccgactggaacacgctggtg
ttcaacctcggccgccacgaggtgcgcggcttcctgatcgccgcggcgctggcctgggtg
cgcgaccatcatgtcgacggcttgcgcgtcgacgcggtggcctcgatgctctaccgcgac
tattcgcgcgcctcgggcgagtgggtgccgaacgtgcacggcgggcgcgagaacttggaa
tcgatcgccttcctgcgcgggctcaacgacaccctgcacggcccgctcgcgccgcccggc
gtgctgagcatcgccgaggaatcgaccgcctggcccggcgtgacggcgcccaccgcgcat
ggcggcctgggcttcgacttcaagtggaacatgggctggatgcacgacacgctgtcctac
ctcggcgaggacccgatacatcgccgccatcaccacgaccgcatcggcttcggcctggtc
tacgccttctccgagcgcttcgtgctgccgctctcgcacgacgaggtggtgcacggcaag
ggctcgctgctggccaaggtgccgggagacgcctggcagcgcttcgccacgctgcgcgcc
tactacggcttcatgtgggcgcatccgggcaagaagctgctgttcatgggcggcgagttc
gcccagcccggcgagttctcgcacgacggccagccgccctgggacctgctcgacgcgccc
gcgcatcgcggcgtgcagcgcctggtgcgcgacctgaaccgcctgagcgccgacgaaccg
gccttgtaccggctcgacagccggcccgagggattcggctggctggtcggcgacgacgcc
agcaacagcgtctatgccttccagcgccgcgacgacagcggccgcgtgctggtcgccatc
tgcaacttcacgccggtgccgcgcgagggctaccgcgtcgggctgccggcgggcgggcgc
tggatcgagctgctcaacaccgacagcgcggcctacggcggcaccaatagcggcaacggc
ggcgcggtccaggcgcaggacgtgccggcgcatggccagtcctggtcggcggagctgcgc
ctgccgccgctggccacgctctggctgcgcccggattga

DBGET integrated database retrieval system