KEGG   Burkholderia gladioli: bgla_2g10430Help
Entry
bgla_2g10430      CDS       T01464                                 

Definition
Alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bgd  Burkholderia gladioli
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    bgla_2g10430
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bgla_2g10430
  Lipid metabolism
   00071 Fatty acid degradation
    bgla_2g10430
  Amino acid metabolism
   00350 Tyrosine metabolism
    bgla_2g10430
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    bgla_2g10430
   00626 Naphthalene degradation
    bgla_2g10430
Enzymes [BR:bgd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     bgla_2g10430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1301265..1302443)
Genome map
AA seq 392 aa AA seqDB search
MQSFSFQTVPHIVLEAGLARRLGELLRERHAGRRACVLTDAFLHRGGTLAPALDSLARAG
WEVLVIDEVVADPPEEVVRDAARRAREFGAELVIGLGGGSSMDVAKLVAALCASEQPLEQ
MYGVNRVEHGRLPLVQIPTTAGTGSEVTPISIVTTGKTTKSGVVSPRLYADSALLDPELT
VGLPPAATAATGIDAMVHAIEAYTSKRLKNPLSDHLACKALQLLTANLLPACRDGQNLAA
RSAMLLGAMLAGQAFANAPVGGVHALAYPIGGVFHVPHGLSNALVLPHVLRFNAQAAAQQ
YAELGQLVGLEPVGPVEEQAEAFIAYLVRLARDAGLPANLQAVGIDVGDLAGLAADAMKQ
ERLLINNPCEIDEASALEIYRRAFEHVYDEVQ
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcgttttcgtttcagaccgtcccccacatcgtgctcgaggcggggctcgcgcgc
cggctcggcgagttgctgcgcgagcgccacgccggtcgccgcgcctgcgtgctcaccgac
gccttcctgcatcgcggcggcacgctcgcgccggcgctggacagcctggcgcgggccggc
tgggaggtgctggtgatcgacgaggtggtggccgacccgcccgaggaggtggtgcgcgac
gcggcccggcgcgcgcgcgaattcggcgccgagctggtgatcgggctgggcggcggctcc
tcgatggacgtcgccaagctggtggccgcgctgtgcgcgagcgagcagccgctggagcag
atgtacggcgtgaaccgcgtcgagcatggccgcctgccgctggtgcagatcccgaccacg
gccggcaccggctccgaggtcacgccgatctcgatcgtgaccaccggcaagaccaccaag
agcggcgtggtctcgccgcggctctacgccgattcggccttgctggacccggagctgacg
gtcggcctgccgccggcggcgaccgccgccaccggcatcgacgcgatggtgcacgcgatc
gaggcctataccagcaagcgtctgaagaatccgctgtcggaccatctcgcctgcaaggca
ttgcaattgctcaccgccaacctgctgccggcctgccgcgacggccagaacctcgccgcg
cgctcggccatgctgctcggcgcgatgctggccggccaggccttcgcgaatgcgccggtg
ggcggcgtgcatgcgctggcctacccgatcggcggcgtgttccatgtgccgcacgggctg
tcgaatgcgctggtgctgccgcacgtgctgcgcttcaacgcgcaggccgccgcgcagcag
tatgccgagctcgggcagttggtcgggctcgagccggtcggcccggtcgaggaacaggcc
gaggccttcatcgcctacctggtgcggctggcgcgcgacgcggggctgccggccaacctg
caggcggtcggcatcgacgtcggcgacctggcggggctggcggccgacgcgatgaagcag
gagcggctgctgatcaataatccctgcgagatcgacgaggccagcgcgctggagatctac
cggcgcgcgttcgagcacgtctacgacgaggtgcaatag

DBGET integrated database retrieval system