KEGG   Burkholderia gladioli BSR3: bgla_2g10430Help
Entry
bgla_2g10430      CDS       T01464                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00010  Glycolysis / Gluconeogenesis
bgd00071  Fatty acid degradation
bgd00350  Tyrosine metabolism
bgd00625  Chloroalkane and chloroalkene degradation
bgd00626  Naphthalene degradation
bgd01100  Metabolic pathways
bgd01110  Biosynthesis of secondary metabolites
bgd01120  Microbial metabolism in diverse environments
bgd01130  Biosynthesis of antibiotics
bgd01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bgla_2g10430
  Lipid metabolism
   00071 Fatty acid degradation
    bgla_2g10430
  Amino acid metabolism
   00350 Tyrosine metabolism
    bgla_2g10430
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    bgla_2g10430
   00626 Naphthalene degradation
    bgla_2g10430
Enzymes [BR:bgd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     bgla_2g10430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Peripla_BP_6 DUF4620
Motif
Other DBs
NCBI-ProteinID: AEA63495
UniProt: F2LKP0
Position
2:complement(1301265..1302443)
Genome map
AA seq 392 aa AA seqDB search
MQSFSFQTVPHIVLEAGLARRLGELLRERHAGRRACVLTDAFLHRGGTLAPALDSLARAG
WEVLVIDEVVADPPEEVVRDAARRAREFGAELVIGLGGGSSMDVAKLVAALCASEQPLEQ
MYGVNRVEHGRLPLVQIPTTAGTGSEVTPISIVTTGKTTKSGVVSPRLYADSALLDPELT
VGLPPAATAATGIDAMVHAIEAYTSKRLKNPLSDHLACKALQLLTANLLPACRDGQNLAA
RSAMLLGAMLAGQAFANAPVGGVHALAYPIGGVFHVPHGLSNALVLPHVLRFNAQAAAQQ
YAELGQLVGLEPVGPVEEQAEAFIAYLVRLARDAGLPANLQAVGIDVGDLAGLAADAMKQ
ERLLINNPCEIDEASALEIYRRAFEHVYDEVQ
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcgttttcgtttcagaccgtcccccacatcgtgctcgaggcggggctcgcgcgc
cggctcggcgagttgctgcgcgagcgccacgccggtcgccgcgcctgcgtgctcaccgac
gccttcctgcatcgcggcggcacgctcgcgccggcgctggacagcctggcgcgggccggc
tgggaggtgctggtgatcgacgaggtggtggccgacccgcccgaggaggtggtgcgcgac
gcggcccggcgcgcgcgcgaattcggcgccgagctggtgatcgggctgggcggcggctcc
tcgatggacgtcgccaagctggtggccgcgctgtgcgcgagcgagcagccgctggagcag
atgtacggcgtgaaccgcgtcgagcatggccgcctgccgctggtgcagatcccgaccacg
gccggcaccggctccgaggtcacgccgatctcgatcgtgaccaccggcaagaccaccaag
agcggcgtggtctcgccgcggctctacgccgattcggccttgctggacccggagctgacg
gtcggcctgccgccggcggcgaccgccgccaccggcatcgacgcgatggtgcacgcgatc
gaggcctataccagcaagcgtctgaagaatccgctgtcggaccatctcgcctgcaaggca
ttgcaattgctcaccgccaacctgctgccggcctgccgcgacggccagaacctcgccgcg
cgctcggccatgctgctcggcgcgatgctggccggccaggccttcgcgaatgcgccggtg
ggcggcgtgcatgcgctggcctacccgatcggcggcgtgttccatgtgccgcacgggctg
tcgaatgcgctggtgctgccgcacgtgctgcgcttcaacgcgcaggccgccgcgcagcag
tatgccgagctcgggcagttggtcgggctcgagccggtcggcccggtcgaggaacaggcc
gaggccttcatcgcctacctggtgcggctggcgcgcgacgcggggctgccggccaacctg
caggcggtcggcatcgacgtcggcgacctggcggggctggcggccgacgcgatgaagcag
gagcggctgctgatcaataatccctgcgagatcgacgaggccagcgcgctggagatctac
cggcgcgcgttcgagcacgtctacgacgaggtgcaatag

DBGET integrated database retrieval system