KEGG   Burkholderia gladioli: bgla_2g11640Help
Entry
bgla_2g11640      CDS       T01464                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bgd  Burkholderia gladioli
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bgla_2g11640
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bgla_2g11640
   00052 Galactose metabolism
    bgla_2g11640
   00500 Starch and sucrose metabolism
    bgla_2g11640
   00520 Amino sugar and nucleotide sugar metabolism
    bgla_2g11640
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    bgla_2g11640
   00524 Butirosin and neomycin biosynthesis
    bgla_2g11640
Enzymes [BR:bgd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     bgla_2g11640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1463925..1464950
Genome map
AA seq 341 aa AA seqDB search
MSEEAAGRMGPGGKGGAAAAGCLLAIDFGGTKIAMATATPSGERLGEAEIPTLAAEGAAR
VLARTREAGLALLARTRREHRGAGDAGALPLLAVAAVTPGIVQPDGIRFAPNNPGWETLA
LEPALRRMFEVRVVGVATDVKAAALAEARFGALAGVGTGLYVNLGTGLAAAAVIDGRVLR
GAHGAAGEIGYQLLGVAGERACAEGGAPLEEHAGGGALAARVSALLGRETSAREAFALAA
TQPAVAALLDEALDTLARHVANLALMIDPERIVLGGGMARVPALVERLRAAVARAALFEP
QWQRAAFGHGAALQGAIVVALDALRESAQGAVQPGAAIAAA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggaagcggcagggcggatgggaccgggcggcaagggcggggcagcggcggcg
ggctgcctgctggcgatcgatttcggcggcaccaagatcgccatggcgaccgccacgcca
tcgggcgagcgcctcggcgaggcggaaatcccgacgctggccgccgagggcgcggcgcgc
gtgctggcgcgcacgcgcgaggccggtctcgcgttgctggcgcgcacgcgccgcgagcat
cgaggggcgggcgatgccggcgcgctgcccttgctggcggtggcggccgtcacgcccggc
atcgtgcagcccgacgggatccggttcgcgccgaacaatcccggctgggagacgctcgcg
ctcgagccggcgctgcgccggatgttcgaggtgcgagtggtgggcgtggcgaccgacgtg
aaggccgcggccctggccgaggcgcgcttcggcgcgctggccggggtcggcacggggctc
tacgtgaacctcggcacggggcttgcggcggcggccgtgatcgacgggcgcgtgctgcgc
ggcgcgcacggcgcggccggcgagatcggctaccagttgctcggcgtggccggcgagcgc
gcctgcgccgagggcggcgcgccgctggaggaacacgcgggcggcggcgcgctggccgcg
cgcgtgtcggcgctgctcgggcgcgagaccagtgcgcgcgaggccttcgcgctggccgcc
acgcaacccgcggtggccgcgctgctcgacgaggcgctcgacacgctggcgcgccatgtc
gccaatctcgccttgatgatcgatcccgagcgcatcgtgctgggcggcggcatggcgcgc
gtgccggcgctggtggagcggcttcgcgccgccgtggcgcgcgccgcgctgttcgagccg
caatggcagcgtgccgccttcggccatggcgcggccctgcaaggggcgatcgtggtcgcg
ctcgatgccttgcgcgagtccgcgcagggggcagtgcagccgggtgcggcgatcgccgcg
gcctga

DBGET integrated database retrieval system