KEGG   Burkholderia gladioli: bgla_2g11900Help
Entry
bgla_2g11900      CDS       T01464                                 

Definition
Alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bgd  Burkholderia gladioli
Brite
Enzymes [BR:bgd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     bgla_2g11900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1496985..1497911
Genome map
AA seq 308 aa AA seqDB search
MGASDSGLTRATAKPSAAAPIFAEGDGHAVLLLHGLSSSPLELRYLARYLQDEGFTICAP
VIEGYSAGSAELPMERWIEGAVREYDALAARYERVSVVGLSIGGALALRLIQERPDAQAL
ALLSLTLTYNGWAIPWYRFILDLAYYTPLRHRYRYREAEPFGLRNEALRAKIARAMERDA
FSEVGPSEISLPALHQANRLARLARRQLGEIENDTLVIHSIDDETSSPRNPNTIIERIGA
SFLRTIWLDDSYHMITSDNEREIVARETALFLRESEIAHGAGAGAPPVVSKALARRLRQL
AAVARKTK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgagcgacagcggcctgacccgggcgacggccaaaccctccgccgccgcgccg
atcttcgccgagggcgacggccacgcggtgctgctgctgcacggcctgtccagttccccg
ctcgagctgcgctatctcgcgcgctacctgcaggacgagggcttcacgatctgcgcgccg
gtgatcgagggctacagcgccggctcggccgagctgccgatggagcgctggatcgagggc
gcggtgcgcgaatacgatgcgctggccgcgcgctacgaacgcgtctcggtggtcgggctg
tcgatcggcggggcgctggcgctgcggctgatccaggagcgtcccgacgcgcaggcgctg
gccctgctgtcgctgacgctgacctacaacggctgggcgatcccctggtaccgcttcatc
ctcgacctggcctactacacgccgctgcggcaccgctatcgctaccgcgaggccgagccc
ttcgggctgcgcaacgaggcgctgcgcgccaagatcgcgcgcgccatggagcgcgacgcg
ttcagcgaggtcggcccgtccgagatctcgctgccggcgctgcaccaggcgaaccggctg
gcgcggctggcgcgccggcagctcggcgagatcgagaacgacaccctggtgatccactcg
atcgacgacgagacctccagcccgcgcaacccgaacaccatcatcgagcggatcggcgcg
agcttcctgcgcaccatctggctcgacgattcgtatcacatgatcacttccgacaacgaa
cgggaaatcgtcgcgcgcgagaccgcgctgttcctgcgcgagagcgagattgcgcacggc
gccggcgcgggggcgccgccggtcgtgtcgaaagcgctcgcgcggcggctgcgccagctc
gcggcggtggcccgcaagaccaagtga

DBGET integrated database retrieval system