KEGG   Burkholderia gladioli: bgla_2g15650Help
Entry
bgla_2g15650      CDS       T01464                                 

Definition
ROK domain containing protein
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
bgd  Burkholderia gladioli
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bgla_2g15650
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bgla_2g15650
   00520 Amino sugar and nucleotide sugar metabolism
    bgla_2g15650
Enzymes [BR:bgd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     bgla_2g15650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1960158..1960949
Genome map
AA seq 263 aa AA seqDB search
MKPGKKPSTKPHDAADSTGARDAGPTLSIDIGGSGLKAAIVDADATLRSKRVRVATPHPC
PPDLLVETLHGLVAPLLASDPVAQVSIGFPGFVRDNHVLTAPHLGGPEWRDVPLAARLGE
RLGIAAVRMINDAEMQGLAAIEGRGLEFVLTLGTGAGTALFRDGELMPHLELAHHRVSKK
HAYDEYIGDAARRKAGKARWNRRVEKVIGIIESLVHFDKLWIGGGNAARLKFELPANVAT
VPNDRGIEGGALLWHPRSVRETR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaggcaagaaaccgagcaccaagccgcatgacgcggccgattccaccggcgcg
cgcgacgccgggccgaccttgtcgatcgacatcggcggcagcggtctcaaggcggcgatc
gtcgacgccgacgccacgctgcgctccaagcgtgtgcgcgtggcgacgccgcatccatgt
ccgccggacctgctggtcgagacgctgcacgggttggtcgcgccgctgctggcgagcgat
ccggtcgcgcaggtctcgatcggctttccggggttcgtgcgcgacaaccacgtactgacg
gcgccccatctgggcggccccgagtggcgcgacgtgccgctcgcggcgaggctgggggag
cggctcggcatcgccgccgtgcgcatgatcaacgatgccgagatgcagggcctcgcggcg
atcgagggccgcggcctcgagttcgtgctgacgctcggcaccggggcgggcacggcgctg
tttcgagacggcgagctgatgccgcatctcgaactcgcccatcatcgcgtcagcaagaag
cacgcgtacgacgagtacatcggcgacgccgcgcgccgcaaggccggcaaggcgcggtgg
aaccgtcgcgtcgagaaggtgatcggcatcatcgaatcgctcgtgcatttcgacaagctc
tggatcggcggcggcaacgccgcgcgtctcaaattcgagctgccggccaacgtcgcgacc
gtgccgaacgatcgcggcatcgagggcggcgcgctgctgtggcatccgcgctcggtgcgc
gagacgcgctga

DBGET integrated database retrieval system