KEGG   Burkholderia gladioli: bgla_2g15650Help
Entry
bgla_2g15650      CDS       T01464                                 

Definition
ROK domain containing protein
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
bgd  Burkholderia gladioli
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bgd01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bgd00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bgd00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1960158..1960949
Genome map
AA seq 263 aa AA seqDB search
MKPGKKPSTKPHDAADSTGARDAGPTLSIDIGGSGLKAAIVDADATLRSKRVRVATPHPC
PPDLLVETLHGLVAPLLASDPVAQVSIGFPGFVRDNHVLTAPHLGGPEWRDVPLAARLGE
RLGIAAVRMINDAEMQGLAAIEGRGLEFVLTLGTGAGTALFRDGELMPHLELAHHRVSKK
HAYDEYIGDAARRKAGKARWNRRVEKVIGIIESLVHFDKLWIGGGNAARLKFELPANVAT
VPNDRGIEGGALLWHPRSVRETR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaggcaagaaaccgagcaccaagccgcatgacgcggccgattccaccggcgcg
cgcgacgccgggccgaccttgtcgatcgacatcggcggcagcggtctcaaggcggcgatc
gtcgacgccgacgccacgctgcgctccaagcgtgtgcgcgtggcgacgccgcatccatgt
ccgccggacctgctggtcgagacgctgcacgggttggtcgcgccgctgctggcgagcgat
ccggtcgcgcaggtctcgatcggctttccggggttcgtgcgcgacaaccacgtactgacg
gcgccccatctgggcggccccgagtggcgcgacgtgccgctcgcggcgaggctgggggag
cggctcggcatcgccgccgtgcgcatgatcaacgatgccgagatgcagggcctcgcggcg
atcgagggccgcggcctcgagttcgtgctgacgctcggcaccggggcgggcacggcgctg
tttcgagacggcgagctgatgccgcatctcgaactcgcccatcatcgcgtcagcaagaag
cacgcgtacgacgagtacatcggcgacgccgcgcgccgcaaggccggcaaggcgcggtgg
aaccgtcgcgtcgagaaggtgatcggcatcatcgaatcgctcgtgcatttcgacaagctc
tggatcggcggcggcaacgccgcgcgtctcaaattcgagctgccggccaacgtcgcgacc
gtgccgaacgatcgcggcatcgagggcggcgcgctgctgtggcatccgcgctcggtgcgc
gagacgcgctga

DBGET integrated database retrieval system