KEGG   Burkholderia gladioli BSR3: bgla_2g15650Help
Entry
bgla_2g15650      CDS       T01464                                 

Definition
(GenBank) ROK domain containing protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00010  Glycolysis / Gluconeogenesis
bgd00520  Amino sugar and nucleotide sugar metabolism
bgd01100  Metabolic pathways
bgd01110  Biosynthesis of secondary metabolites
bgd01120  Microbial metabolism in diverse environments
bgd01130  Biosynthesis of antibiotics
bgd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bgla_2g15650
   00520 Amino sugar and nucleotide sugar metabolism
    bgla_2g15650
Enzymes [BR:bgd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     bgla_2g15650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEA64010
UniProt: F2LM84
Position
2:1960158..1960949
Genome map
AA seq 263 aa AA seqDB search
MKPGKKPSTKPHDAADSTGARDAGPTLSIDIGGSGLKAAIVDADATLRSKRVRVATPHPC
PPDLLVETLHGLVAPLLASDPVAQVSIGFPGFVRDNHVLTAPHLGGPEWRDVPLAARLGE
RLGIAAVRMINDAEMQGLAAIEGRGLEFVLTLGTGAGTALFRDGELMPHLELAHHRVSKK
HAYDEYIGDAARRKAGKARWNRRVEKVIGIIESLVHFDKLWIGGGNAARLKFELPANVAT
VPNDRGIEGGALLWHPRSVRETR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaggcaagaaaccgagcaccaagccgcatgacgcggccgattccaccggcgcg
cgcgacgccgggccgaccttgtcgatcgacatcggcggcagcggtctcaaggcggcgatc
gtcgacgccgacgccacgctgcgctccaagcgtgtgcgcgtggcgacgccgcatccatgt
ccgccggacctgctggtcgagacgctgcacgggttggtcgcgccgctgctggcgagcgat
ccggtcgcgcaggtctcgatcggctttccggggttcgtgcgcgacaaccacgtactgacg
gcgccccatctgggcggccccgagtggcgcgacgtgccgctcgcggcgaggctgggggag
cggctcggcatcgccgccgtgcgcatgatcaacgatgccgagatgcagggcctcgcggcg
atcgagggccgcggcctcgagttcgtgctgacgctcggcaccggggcgggcacggcgctg
tttcgagacggcgagctgatgccgcatctcgaactcgcccatcatcgcgtcagcaagaag
cacgcgtacgacgagtacatcggcgacgccgcgcgccgcaaggccggcaaggcgcggtgg
aaccgtcgcgtcgagaaggtgatcggcatcatcgaatcgctcgtgcatttcgacaagctc
tggatcggcggcggcaacgccgcgcgtctcaaattcgagctgccggccaacgtcgcgacc
gtgccgaacgatcgcggcatcgagggcggcgcgctgctgtggcatccgcgctcggtgcgc
gagacgcgctga

DBGET integrated database retrieval system