KEGG   Burkholderia gladioli: bgla_2g17570Help
Entry
bgla_2g17570      CDS       T01464                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
bgd  Burkholderia gladioli
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    bgla_2g17570
Enzymes [BR:bgd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     bgla_2g17570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2233616..2234935)
Genome map
AA seq 439 aa AA seqDB search
MFLPQEFIRKKRDRQPLSRDEIAAFVSGITDGSVTEGQVAAFAMAVFFNDLAVEERVALT
LAQRDSGQVLEWRSLALDGPVIDKHSTGGVGDVVSLMLGPMIAACGGYVPMISGRGLGHT
GGTLDKLSAIPGYDVTPDPELLRRTVREVGVAIIGQTAQLAPADKRIYAIRDVTATVESV
AMITASILSKKLAAGLEGLVMDVKVGSGAFMPSFEKSVELAQSIVDVGNGAGMKTTAVLT
DMNQSLAPCAGNAIEVLCAIDYLSGKSRPARLHEVTMALTAEMLVTGGLAADEAQARAAL
QRALDSGAAAERFATMVAALGGPKDLVEAPARYLAAAAVKVPVPAPAGGVVQRVDCRGLG
LAVVALGGGRTRAEDSIDYSVGLSDLVELGQQVNAGDPLGYVHARDQATAARALAEVQRA
YLLGASAEPLPPTIHRLVR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgccccaggaattcatccgcaagaagcgcgatcgccagccgctgagccgcgac
gagatcgcggccttcgtcagcggcatcaccgacggcagcgtgaccgagggccaggtggcc
gcgttcgcgatggcggtgttcttcaacgacctggccgtcgaggagcgcgtggccctcacg
ctcgcgcagcgcgattccggccaggtgctggaatggcgctcgctggcgctcgacggcccg
gtgatcgacaagcattcgaccgggggcgtgggcgacgtggtgtccctgatgctcgggccg
atgatcgccgcctgcggcggctacgtgccgatgatctcggggcgcgggctcggtcacacc
ggcggcacgctcgacaagctgagcgcgatccccggctatgacgtcacgcccgatccggag
ctgctgcgccgcacggtgcgcgaggtcggcgtggccatcatcggccagaccgcccagctg
gcgccggccgacaagcgcatctacgcgatccgcgacgtgacggcgacggtggaatcggtc
gccatgatcaccgcctcgatcctctccaagaagctggcggccgggctcgaagggctggtg
atggacgtcaaggtcggctcgggcgccttcatgccgagcttcgagaaatcggtcgagctg
gcgcagagcatcgtcgatgtcggcaacggcgccggcatgaagaccaccgccgtgctgacc
gacatgaaccagtcgctggcaccctgtgccggcaacgcgatagaggtgctctgcgcgatc
gactacctgagcggcaagtcgcgtccggcgcggctgcacgaggtcaccatggcgctcacg
gccgagatgctggtgacgggcggcctggccgccgacgaggcgcaggcgcgcgccgccttg
cagcgcgcgctcgattccggcgcggcggccgagcgtttcgcgaccatggtggccgcgctc
ggcggcccgaaggacctggtcgaggcgccggcgcgatacctggctgccgccgcggtgaag
gtgccggttccggcgccggccggcggcgtggtgcagcgcgtcgactgccgcgggctcggc
ctggcggtggtggcgctcggcggtggccgcacgcgcgcggaagactcgatcgattattcg
gtcggcctgtcggatctcgtcgaactcgggcagcaggtcaacgcgggcgatccgctcggc
tacgtgcatgcgcgcgaccaagcgaccgccgcgcgcgcgctggcggaggtgcagcgcgcc
tacctgctcggcgccagcgccgagccgctgccgcccaccattcaccggctggttcgttaa

DBGET integrated database retrieval system