KEGG   Burkholderia gladioli BSR3: bgla_2g18110Help
Entry
bgla_2g18110      CDS       T01464                                 

Definition
(GenBank) Tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00260  Glycine, serine and threonine metabolism
bgd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bgd01100  Metabolic pathways
bgd01110  Biosynthesis of secondary metabolites
bgd01130  Biosynthesis of antibiotics
bgd01230  Biosynthesis of amino acids
Module
bgd_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bgla_2g18110
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    bgla_2g18110
Enzymes [BR:bgd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     bgla_2g18110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Peripla_BP_6 PcrB His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: AEA64249
UniProt: F2LMG5
Position
2:complement(2300754..2301566)
Genome map
AA seq 270 aa AA seqDB search
MSRIQNTFAALAAQGRKGLIPFLTAGDPDPAKTVEFMHALAEGGADVIELGVPFSDPMAD
GPVIQRSSERALARGVTLRHVLDDVKRFRERDDHTPVVLMGYANPIERMGAEAFAAAAAA
AGVDGVLVVDYPPEEAAGFAATMRAAGIDPIFLLAPTSTEERMAEVGRIASGYVYYVSLK
GVTGAGNLDVSSIAGKIPAIKSRVPVPVGVGFGIRDAATARAVAEVSDAVVIGSRLVQLL
EEAAPEAAVGVLKAFIAEIRAALDGEARAA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtatccagaacacctttgcagcactcgccgcccagggccgtaagggcctgatc
cccttcctcacggcgggcgacccggacccggcgaaaaccgtcgaattcatgcacgcgctg
gccgaaggcggcgccgatgtgatcgagctcggcgtgccgttttccgacccgatggccgac
ggcccggtgatccagcgttcgtccgagcgcgcgctggcgcgcggcgtgacgctgcggcac
gtgctggacgacgtcaagcgcttccgcgagcgcgacgaccacaccccggtggtgctgatg
ggttatgccaacccgatcgagcgcatgggcgccgaggccttcgccgcggcggccgccgcg
gccggcgtcgacggcgtgctggtggtcgactaccctcccgaggaagcggccggtttcgcc
gccacgatgcgcgccgccggcatcgaccccattttcctgctggcgcccacctcgaccgag
gaacggatggccgaagtggggcggatcgccagcggttatgtctattacgtgtcgctgaaa
ggggtgacgggcgccggaaatctggatgtttccagcattgcgggtaaaatcccggccatc
aagtcgcgcgtgccggttccggtcggcgtcggcttcgggatccgcgacgccgccacggcg
cgcgcggtggccgaagtttccgacgcggtcgtgatcggcagccgcctcgtgcaactgctc
gaggaagcggcgccggaggcggcggtgggcgtgctcaaggccttcatcgccgagatccgc
gccgcgctcgacggcgaggccagggcggcctga

DBGET integrated database retrieval system