KEGG   Burkholderia gladioli BSR3: bgla_2g18130Help
Entry
bgla_2g18130      CDS       T01464                                 

Definition
(GenBank) Tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    bgla_2g18130
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bgla_2g18130
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    bgla_2g18130
Enzymes [BR:bgd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     bgla_2g18130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:complement(2302487..2303680)
Genome map
AA seq 397 aa AA seqDB search
MYDLPDDRGHFGPYGGVFVAETLIHALDELREAYDRFRDDPEFVAEYNRELKHFVGRPSP
IYHAQRWSELLGGAQLYLKREDLNHTGAHKINNVIGQALLARRMGKKRVIAETGAGQHGV
ATATICARFGMECIVYMGSEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNIETTFYIIGTVAGPHPYPMLVRDFQRVIGDECKVQMPEMAGRQPDAVIACVGGGSNA
MGIFYPYIDDTNVQLIGVEAAGDGLDTGRHAASLTGGSPGVLHGNRTYLLQDDDGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVPITDEEALKAFHDCCRIEGIIPALESSHAIAY
GAKLAATLPKDRILLVNLSGRGDKDMHTVAERGGIVL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaccttcctgatgatcgcggccacttcggcccgtatggcggcgtgttcgtcgcc
gaaaccctgatccacgcgctcgacgagctgcgcgaggcctacgaccgctttcgcgacgat
cccgagttcgtcgccgagtacaaccgcgagctcaagcacttcgtcggccgtccctcgccg
atctaccacgcgcagcgctggagcgaactgctcggcggcgcgcagttgtacctgaagcgc
gaggacctgaaccacaccggcgcgcacaagatcaacaacgtgatcggccaggcgctgctg
gcgcgccggatgggcaagaagcgcgtgatcgccgagaccggcgcgggccagcacggcgtg
gccaccgccaccatctgcgcgcgcttcggcatggagtgcatcgtctacatgggttccgag
gacgtgcgccgccaggccgccaacgtctaccgcatgaagctgctcggcgcgaccgtggtg
ccggtcgaatcgggctcgcgcacgctcaaggacgcgctcaacgaggcgatgcgcgactgg
gtcaccaacatcgagaccaccttctacatcatcggcacggtggccggcccgcatccgtat
ccgatgctggtgcgcgacttccagcgcgtgatcggcgacgagtgcaaggtgcagatgccc
gagatggcggggcgtcagcccgacgcggtgatcgcctgcgtgggcggcggctcgaacgcg
atggggatcttctacccgtacatcgacgatacgaacgtccagttgatcggcgtcgaggcg
gccggcgacgggctcgacacgggccgccacgcggcctcgctgacgggcggcagccccggc
gtgctgcacggcaaccgcacctacctgctgcaggacgacgacggccagatcatcgagacg
cattcggtatcggccggcctcgactatcccggcgtcggccccgagcacgcctggctcaag
gacagcggccgcgcgcaatacgtgccgatcaccgacgaggaagcgctgaaggccttccac
gactgctgccggatcgagggcatcatcccggcgctcgagtcgagccacgcgatcgcctac
ggcgccaagctcgccgcgaccctgccgaaggaccgcatcctgctggtcaatctgtcgggc
cgcggcgacaaggacatgcataccgtcgcggaacgcggcggcatcgtgctctga

DBGET integrated database retrieval system