KEGG   Burkholderia gladioli BSR3: bgla_2g18300Help
Entry
bgla_2g18300      CDS       T01464                                 

Definition
(GenBank) Succinate dehydrogenase, cytochrome b subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00020  Citrate cycle (TCA cycle)
bgd00190  Oxidative phosphorylation
bgd00650  Butanoate metabolism
bgd01100  Metabolic pathways
bgd01110  Biosynthesis of secondary metabolites
bgd01120  Microbial metabolism in diverse environments
bgd01130  Biosynthesis of antibiotics
bgd01200  Carbon metabolism
Module
bgd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bgd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bgd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    bgla_2g18300
   00650 Butanoate metabolism
    bgla_2g18300
  Energy metabolism
   00190 Oxidative phosphorylation
    bgla_2g18300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Phage_holin_2_3
Motif
Other DBs
NCBI-ProteinID: AEA64267
UniProt: F2LNE6
Position
2:complement(2321299..2321667)
Genome map
AA seq 122 aa AA seqDB search
MAGNNRIGSKRLVVGAHYGLRDWLAQRITGVIMAVYTVILLAWFFAARDFSYDGWASIFA
TQWMKLATFVTLLALFYHAWVGIRDIWMDYVKPVGVRLLLQSLTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaacaaccgaatcggctcgaagcgcctcgtggtcggcgctcactacggcctg
cgcgactggctcgcgcaacgcatcaccggcgtcatcatggcggtctacaccgtgatcctg
ctcgcctggttcttcgcggcgcgcgatttctcctacgacggctgggcatcgatcttcgcc
acgcaatggatgaagctcgcgaccttcgtcacgctgctggcgctgttctatcacgcctgg
gtcggcattcgcgatatctggatggattacgtgaagccggtcggcgtgcggctgctgctg
caatcgctgacgatcgtctggctgctcgcgtgcgcgggctacgccgcgcagattctctgg
agagtgtaa

DBGET integrated database retrieval system