KEGG   Burkholderia gladioli: bgla_2g18300Help
Entry
bgla_2g18300      CDS       T01464                                 

Definition
Succinate dehydrogenase, cytochrome b subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
bgd  Burkholderia gladioli
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bgla_2g18300
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    bgla_2g18300
   00650 Butanoate metabolism
    bgla_2g18300
  Energy metabolism
   00190 Oxidative phosphorylation
    bgla_2g18300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2321299..2321667)
Genome map
AA seq 122 aa AA seqDB search
MAGNNRIGSKRLVVGAHYGLRDWLAQRITGVIMAVYTVILLAWFFAARDFSYDGWASIFA
TQWMKLATFVTLLALFYHAWVGIRDIWMDYVKPVGVRLLLQSLTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaacaaccgaatcggctcgaagcgcctcgtggtcggcgctcactacggcctg
cgcgactggctcgcgcaacgcatcaccggcgtcatcatggcggtctacaccgtgatcctg
ctcgcctggttcttcgcggcgcgcgatttctcctacgacggctgggcatcgatcttcgcc
acgcaatggatgaagctcgcgaccttcgtcacgctgctggcgctgttctatcacgcctgg
gtcggcattcgcgatatctggatggattacgtgaagccggtcggcgtgcggctgctgctg
caatcgctgacgatcgtctggctgctcgcgtgcgcgggctacgccgcgcagattctctgg
agagtgtaa

DBGET integrated database retrieval system