KEGG   Burkholderia gladioli: bgla_2g19540Help
Entry
bgla_2g19540      CDS       T01464                                 

Definition
putative ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bgd  Burkholderia gladioli
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    bgla_2g19540
Enzymes [BR:bgd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     bgla_2g19540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2481295..2482221
Genome map
AA seq 308 aa AA seqDB search
METIAVIGSNMVDLVTYVERMPVRGETLEAPSFELGCGGKGANQAVAAARLGARVVMVSK
VGDDVFADNTLRNFAREGIDTTHVGRVPGVPSGVAPIFVEPDSSNSILIVKGANRHLVPA
DIEAAAPRLRECALIVLQLEIELETVYHAIEFGARHGIPVLLNPAPATAALDFERIRTVE
FFVPNETELAIVSGMPVDSPEAAARAAQALVARGLKQVLVTLGAQGSLLVSREGVQHVAG
VPVQARDTTGAGDAYIGCFARYYASSRDAASAMRHASAYAAHSVTGFGTQKSYADAAGFE
RFLRDAGR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggagacaatcgccgtgatcggcagcaacatggtcgacctcgtgacctacgtcgagcgc
atgcccgtgcgcggcgagacgctggaggcgccgagcttcgagctcggctgcggcggcaag
ggcgccaaccaggcggtggcggcggcgcgcctgggcgcgcgcgtggtgatggtcagcaag
gtcggcgacgacgtgttcgccgacaacaccctgcgcaacttcgcgcgcgaaggcatcgac
accacccacgtgggccgcgtgcccggcgtgcccagcggcgtggcgccgatcttcgtcgaa
cccgattccagcaacagcatcctgatcgtcaagggcgccaaccggcacctggtgccggcc
gacatcgaggcggccgcgcccaggctgcgcgaatgcgcgctgatcgtgctgcagctcgag
atcgaactcgagaccgtctaccacgcgatcgaattcggcgcgcggcacggcatcccggtg
ctgctgaacccggcgccggccaccgccgcgctcgatttcgagcgaatccgcacggtcgaa
ttcttcgtgcccaacgaaaccgagctggcgatcgtgtccggcatgccggtcgattcgccc
gaggccgcggcgcgtgccgcgcaggcgctggtcgcgcgcggcctcaagcaggtgctggtc
acgctgggcgcccagggttcgctgctggtctcgcgcgagggcgtgcagcacgtcgccggc
gtgccggtgcaggcacgcgacaccaccggcgcgggcgacgcctacatcggctgcttcgcg
cgctactacgcgagttcgcgcgacgcggccagcgccatgcgccacgcctcggcctatgcc
gcgcattcggtcaccggcttcggcacccagaagtcctacgccgacgcggccggcttcgaa
cgcttcctgcgcgacgccggccgctga

DBGET integrated database retrieval system