KEGG   Burkholderia gladioli: bgla_2g23590Help
Entry
bgla_2g23590      CDS       T01464                                 

Definition
Glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bgd  Burkholderia gladioli
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    bgla_2g23590
   00330 Arginine and proline metabolism
    bgla_2g23590
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    bgla_2g23590
Enzymes [BR:bgd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     bgla_2g23590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2959378..2960292
Genome map
AA seq 304 aa AA seqDB search
MNYQSILDRIQSEIAPWIGAGRVADYIPELAKVPAERFGMAIVTLDGQTYTVGDAHERFS
IQSISKLFACTLAFQLLGDELWQRVGREPSGTAFNSLVQLESERGKPRNPFINAGALVVT
DVLSRRFVRAETALVEFIRRLIGSNQIDYDSRVASSELQHAERNRAMAHFMASFGNMWMP
ASTVVDAYCRQCAISMSCVELAQAALFLANGGVAPISGEQIVDASSAKRLSALMLTCGTY
DAAGDFVYRVGLPAKSGVGGGIVAVLPGEMAVCVWSPGLDPNGNSLAGVLALEWLTTYMG
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaattaccaatcgatactcgaccgcatccaatccgaaatcgcgccctggatcggcgcc
gggcgcgtcgccgactacatccccgaactcgccaaggtgccggccgagcgcttcggcatg
gcgatcgtcacgctcgacgggcagacctacacggtcggcgacgcgcacgagcgcttctcg
atccagagcatctccaagctgttcgcctgcacgctggccttccagttgctcggagacgag
ctctggcagcgcgtcggccgcgagccgtcgggcaccgccttcaactcgctggtgcagctc
gagagcgagcgcggcaagccgcgcaatcccttcatcaacgccggcgcgctggtggtgacc
gacgtgctgagccggcgcttcgtgcgcgccgagacggcgctggtggaattcatccgccgc
ctgatcggctccaaccagatcgactacgactcgcgcgtggcgagctccgagctgcagcat
gccgagcgcaaccgcgcgatggcgcacttcatggccagcttcggcaacatgtggatgccg
gcctccacggtggtggacgcctactgccgccagtgcgcgatctcgatgagctgcgtggag
ctggcccaggccgcgctgttcctcgccaacggcggggtggcgccgatcagcggcgagcag
atcgtcgacgccagctcggccaagcggctctcggccctgatgctgacctgcggcacctac
gacgcggccggcgatttcgtctaccgcgtcgggctgccggccaagagcggcgtgggcggc
ggcatcgtcgcggtgctgccgggggagatggcggtctgcgtgtggtcgccggggctggat
ccgaacggcaattcgctggctggggtgctggcgctggagtggctgacgacttatatgggg
cggtcgattttttga

DBGET integrated database retrieval system