KEGG   Burkholderia gladioli: bgla_2g24330Help
Entry
bgla_2g24330      CDS       T01464                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bgd  Burkholderia gladioli
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    bgla_2g24330
Enzymes [BR:bgd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     bgla_2g24330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(3041128..3042093)
Genome map
AA seq 321 aa AA seqDB search
MTQALTVAPRTGHKTLLYSELALDLDHLEADIAVLGMPYGAAYSASDFTNDQTNAPAAIR
QATDRVVRSPGHYDFDIDGPLLQERDDIRFVDCGDVIADLAAPGSHYQRVEAAVRKILAA
GALPIVMGGDHGITTPVLRAFDTLGPITLVHVDAHLDWRDEVNGVREGLSSPIRRASEMK
HVAKIVQIGLRAQGSARPEELRAAQAYGSELVSAYELHDVGMDAVLARIPDNGNYYLTID
ADGLDPSVMPAVAGPAPGGVTFLQARKLIHGLVRKGRVVGMDIVEIQPEKDVNQISCITA
GRLILNLIGSAIRAGYFDGKR
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagccctgacggtcgcgccgcgcaccggccacaagaccctgctgtactcggaa
ctggcactcgacctggaccatctggaggccgacatcgccgtgctcggcatgccctatggc
gcggcctattcggcctccgacttcaccaacgaccagaccaacgcgccggccgcgatccgc
caggcgaccgaccgcgtggtgcgctctcccggccattacgacttcgacatcgacggcccg
ctgctgcaggagcgcgacgacatccgcttcgtcgattgcggcgacgtgatcgccgacctg
gccgcgccgggcagccactaccagcgcgtcgaggccgcggtgcgcaagattctcgcggcc
ggcgcgctgccgatcgtgatgggcggcgaccacggcatcaccacgccggtgctgcgcgcc
ttcgatacgctggggccgatcaccctggtgcatgtcgatgcgcacctggactggcgcgac
gaggtgaacggcgtgcgcgagggcctgtcgagcccgatccgccgcgcctcggagatgaag
cacgtggcgaagatcgtgcagatcggcctgcgcgcgcagggcagcgcgcgccccgaggaa
ctgcgcgcggcgcaggcctacggctcggagctggtgagcgcctacgagctgcacgacgtc
ggcatggatgccgtgctggcgcgcattcccgacaacggcaactactacctgacgatcgac
gccgacgggctcgacccttcggtgatgccggccgtggccggcccggcgccgggcggcgtg
accttcctgcaggcgcgcaagctgatccacggcctggtgaggaagggccgcgtggtcggg
atggacatcgtcgagatccagcccgagaaggacgtcaaccagatctcctgcatcacggcc
ggccgcctgatcctgaacctgatcggcagcgcgatccgcgccggttatttcgacggcaag
cgctga

DBGET integrated database retrieval system