KEGG   Burkholderia gladioli: bgla_2g25030Help
Entry
bgla_2g25030      CDS       T01464                                 

Definition
Di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bgd  Burkholderia gladioli
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:3120822..3122288
Genome map
AA seq 488 aa AA seqDB search
MRTLSLALICVLTALLAACGDDSSGGGASGSSGASAPAGGSSAAASTLSPKAQLGEKIFF
DKTLSGNKNMACASCHDPAYAYGPPNSLSVQLGSDPSQAGVRAVPSLRYKSMTPPYNDNA
DNPDGVTQNAPGGGFMWDGRATSLATQAGLPLLNPIEMNNSSPDAVVKAVQNGAYAALFQ
QVYGNAVFGDTTNAFNAIGDALQQYQNEDQSFAPYSSKFDLYIGNKIGGTLTAAETRGLQ
LFNDTSKGAGCAACHYVGANFNGSTGLMTDFTYQAIGAPRNDTSIPGNPNPIPADADASF
FDMGLCGPYATLHVPGTASSGAGPDSFTGVNVPDPYCGRFKVPTLRNVATRNAFFHNGVF
HSLVQVVNFYNTRDTNPEYWYPATGGTGAPTSNPSFALQPTYLAGATVNRFNDLPADYRG
NIDEELPMGQGQTDAGGTTAADGAQARSFHSAPQLSQKDIADLVCFMKTLSDGYQAPATA
PSSGDCVN
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacgctatctcttgcattgatctgtgtacttaccgcgctgctggctgcctgcggc
gacgactcgtccggcggcggcgcctccggctcgtcgggcgcctcggcgccggccggcggc
agcagcgccgcggcctcgacgctgagccccaaggcgcagctcggcgagaagatcttcttc
gacaagaccctgtcgggcaacaagaacatggcctgcgcgagttgccacgatccggcctat
gcctacgggccgccgaacagcctgtcggtgcagctcggctccgatccgtcgcaggccggc
gtgcgcgcggtgccctcgctgcgctacaagtcgatgacgccgccctacaacgacaatgcc
gacaacccggacggcgtcacgcagaacgcgcccggcggcggcttcatgtgggacggccgc
gccacctcgctggcgacccaggcgggcctgcccctgctgaacccgatcgagatgaacaac
agctcgccggacgcggtggtgaaggccgtgcagaacggcgcctatgccgcgctgttccag
caggtctacggcaacgcggtgttcggcgacaccaccaacgccttcaacgcgatcggcgac
gcgctgcagcagtaccagaacgaggaccaatccttcgcgccctactcgagcaagttcgac
ctctacatcggcaacaagatcggcggcacgctgaccgccgccgagacgcgcggcctgcaa
ctgttcaacgacaccagcaagggcgccggctgcgcggcctgccactacgtgggcgcgaac
ttcaacggctcgaccgggctgatgacggacttcacctaccaggcgatcggcgcgccgcgc
aacgacacctcgatccccggcaacccgaacccgatcccggccgacgcggacgcgagcttc
ttcgacatgggcctctgcggcccctacgcgacgctgcacgtgcccggcacggcatcgagc
ggcgccggccccgattcgttcaccggcgtgaacgtgccggacccgtattgcggccgcttc
aaggtgccgacgctgcgcaacgtggccacccgcaacgcgttcttccacaacggcgtgttc
cactcgctggtgcaggtggtgaacttctacaacacgcgcgataccaaccccgagtactgg
tacccggccaccggcggcaccggcgcgcccaccagcaacccgagcttcgcgctgcagccg
acctacctcgccggcgccaccgtcaaccgcttcaacgacctgccggccgactatcgcggc
aacatcgacgaggagctgccgatgggccagggccagaccgacgcgggcggcaccaccgcc
gccgacggcgcccaggcgcgtagcttccactcggcgccgcagctctcgcagaaggacatc
gccgacctggtctgcttcatgaagacgctcagcgacggctaccaggcgccggccacggcg
ccgagctccggcgactgcgtgaactga

DBGET integrated database retrieval system