KEGG   Burkholderia gladioli: bgla_2g28050Help
Entry
bgla_2g28050      CDS       T01464                                 

Definition
Cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bgd  Burkholderia gladioli
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    bgla_2g28050
Enzymes [BR:bgd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     bgla_2g28050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:3465036..3466256
Genome map
AA seq 406 aa AA seqDB search
MNRSVAHGGLRALAAKASLAAAMLASACAGLANVMPAHAATARAAPIVAAPRCGEWPAYR
AFLAHIVQPDGRVFDASTPAQQSTSEGQSYGLFFALVANDRDSFGRILAWTRANLAGGHF
DAKDARLPAWLWGRRADGSWGVLDPNSAADADLWIAYDLLEAGRLWHVPDYSALGAALAA
QIARREVADLAGLGPMLLPGPQGFVEGDVTRLNPSYLPLPVLRALAGELGGPWNAIARNG
LRLVAGASPRGFAPDWAAWRAGQVVVDPRTGDLGSYDAIRTYLWAGLANPADPLARPWLD
ALRGMAAQVAQSGVPPEKVAVATGVGSGEGPLSYWGALAPYFAALGDARGLALARARLSA
LDADAPGREPVYYDRVLGLFGGGAVEGRYRFDAGGRLLPAWSEACR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttccgttgctcacgggggcctgcgcgccctcgccgccaaggcctcgctggcg
gccgcgatgctggcctcggcctgcgccggcctggcgaacgtcatgcctgcccacgccgcc
acggcacgcgccgcgccgatcgtcgccgcgccgcgttgcggcgaatggcccgcctatcgc
gccttcctcgcgcacatcgtgcagcccgacggccgcgtgttcgacgccagcacgccggcc
cagcagtcgacctcggaaggccagtcctacggcctgttcttcgcgctggtggccaacgat
cgcgacagcttcgggcgcatcctggcatggacccgcgccaacctggccggcggccacttc
gacgccaaggacgcgcgcctgcccgcctggctgtggggccgcagggccgacggcagttgg
ggcgtgctcgatccgaattcggccgccgatgccgacctgtggatcgcctacgacctgctg
gaagccgggcggctctggcacgtgcccgactacagcgcgctcggcgcggcgctggccgcg
cagatcgcgcgccgcgaagtagccgatctggccgggctcggcccgatgctgctgccaggc
ccgcaaggcttcgtcgagggcgacgtgacacgcctgaacccgagttacctgccgctgccg
gtgctgcgcgcactggcgggcgaattgggcggcccgtggaacgccatcgccaggaacggc
ctgcggctggtggccggcgcctcgccgcgcggcttcgcgcccgactgggcggcctggcgc
gccgggcaggtggtggtcgatccgcgcacgggcgacctcggcagctacgacgcgatccgc
acctacctgtgggccggcctcgcgaatccggccgatccgctggcccgtccctggctcgac
gcgctgcgcgggatggccgcgcaggtcgcgcaaagcggcgtgccgcccgagaaggtggcg
gtggccaccggcgtgggcagcggcgagggcccgctcagctactggggcgcgctcgcgccg
tacttcgccgcgctcggcgacgcgcgcggcctggcgctggcgcgtgcccgcctgagcgcg
ctcgatgccgacgcgccgggccgcgaacccgtctactacgaccgcgtgctcggcctgttc
ggcgggggcgccgtggagggccgctaccgcttcgacgcgggcggccggctgctgcccgca
tggagtgaggcatgtcgatga

DBGET integrated database retrieval system