KEGG   Burkholderia gladioli BSR3: bgla_2g28900Help
Entry
bgla_2g28900      CDS       T01464                                 

Definition
(GenBank) Acetyltransferase, GNAT family protein
Organism
bgd  Burkholderia gladioli BSR3
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:complement(3572949..3575315)
Genome map
AA seq 788 aa AA seqDB search
MTVRNLDALFRPKSVAVVGASRRAGSIGAIVWGRVLDGGFAGPAWPVNPKYDELNGQRVF
ARVSQLPEAPSLAIVCTPPATWPGIVKQLGARGARGAILVGEARTAAERASVERALEAAR
PHLLRVVGPGSLGVITPHLNAHFGAPAYRVNAGGVAWVSQSNALTNAALGWAHARGLGFS
HAVALGDEADVDAGDVLDYLASDPGTRAILLELDSVKSARKFMSAARAAARNKPVLALRT
GRADPGDALYTAAFQRAGMVRVEALDDLLDEVETLGVGRIANSNAATVITSDAGVAKLAV
DALGAAGDLRLAPWPAAATEALAAVLPLPRGIEAGNPLLLGDDARPEAFGAAVRALGAHG
AAGTLFVVHATSHNAPVEAVARELIEAQRSASRGIVACFFGGVDAATRDALHAHGIPVHT
TPQRLARAYARLVDYRLGRELLMQTPEGSPPEPPASVVQAQEAARAALARGPAELDGAQA
AAWLAHFGLQGVQTDADARDIIVEVTVEMHDDQNFGPVFRYSVPAADGVSAPLVVYGLPP
FNTVLARAVVRRSPYSRRAEPEPLLEALMALSQAVCEVRELVALSLVLRVLPRHVMIRDA
RLRFATGRGRLAIMPYPRRLEQQLEWRGRTMTVRPIRPEDEAAHTALLGAMTPDDLRMRF
FGSIRSFDHSQVARMTQIDYDREMALIATADDDDGQRQTLGVVRAVADPDNETAEFAIAI
RPDQKGSGLGRLLMGQIIDYARSRGTHWLIGEALRENGAMIGLARASGFAVSAGEEPGVV
AFRLKLRD
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtccgcaatctcgatgccttgttccgaccgaagtccgtcgcggtggtgggcgcg
tcccgccgcgccggcagcatcggcgcgatcgtctggggccgcgtgctcgacggcggcttc
gccggtcccgcctggcccgtcaatcccaagtacgacgaactgaatgggcaacgcgtgttc
gcgcgcgtctcgcaactgcccgaggcgccttcgctggcgatcgtctgcacgccgccggcc
acctggcccggcatcgtcaagcagctcggcgcgcggggcgcgcgcggcgcgatcctggtc
ggcgaggcacgcacggccgccgagcgcgcctcggtcgagcgcgcgctggaggcggcccgg
ccgcacctgctgcgcgtggtcggtccgggcagcctcggcgtgatcacgccgcacctgaac
gcgcatttcggcgcgcccgcctatcgcgtgaatgccggcggcgtggcctgggtctcgcaa
tcgaacgcgctcaccaatgccgcgctcggctgggcgcacgcgcgcggcctcggcttctcg
cacgcggtggcgctcggcgacgaggccgacgtcgacgcgggcgacgtgctcgactacctg
gccagcgatcccggcacgcgcgcgatcctgctcgaactcgatagcgtgaaatcggcgcgc
aagttcatgtcggcggcgcgggcggcggcgcgcaacaagccggtgctggcgctgcgcacc
gggcgcgccgatccgggcgacgcgctctacacggccgccttccagcgggccggcatggtg
cgcgtcgaggcgctcgacgacctgctcgacgaggtcgagacgctcggcgtcggccgcatc
gcgaacagcaatgcagccaccgtgatcaccagcgatgccggcgtggcgaagctcgccgtc
gacgcgctcggcgcggctggcgatctgcgcctggcgccgtggccggccgcggccaccgag
gcgctggccgcggtgctgccgttgccgcgcggcatcgaggcgggcaaccccctgctgctc
ggcgacgacgcgcggcccgaggcgttcggcgccgcggtgcgagcgctcggcgcgcacggc
gcggcgggcacgctgttcgtggtgcatgccacctcgcacaacgcacccgtcgaggcggtc
gcgcgcgagttgatcgaggcgcagcgaagcgcctcgcgcggcatcgtcgcctgcttcttc
ggcggcgtcgacgcggccacgcgcgatgcgctgcacgcgcacggcatccccgtgcacacc
acgccgcagcgcctggcgcgcgcctatgcgcggctggtcgactaccggcttggccgcgag
ctgctgatgcagacgcccgaaggttcgccgcccgagccgccggcctcggtggtgcaagcg
caggaggcagcgcgcgctgcgctcgcgcggggccctgccgaactcgacggcgcgcaggcc
gccgcctggctcgcgcatttcgggctgcagggcgtgcagaccgacgcggatgcgcgcgac
atcatcgtcgaggtcacggtcgagatgcatgacgaccagaacttcggcccggtattccgt
tactcggtgccggcggcggacggcgtgtcggcgccgctggtggtctatgggctgccgcct
ttcaacacggtgctggcgcgcgccgtggtgcgccgctcgccctattcgcgccgtgccgag
cccgagccgctgctcgaggcgctgatggcgctgtcgcaggcggtctgcgaggtgcgggag
ctggtggccctgtcgctggtgctgcgcgtgctgccccggcacgtgatgatccgcgacgcg
cggctgcgtttcgcgacggggcgcgggcggctcgcgatcatgccgtatccgcgccgcctg
gagcagcagctcgaatggcgcggccggaccatgacggtgcggccgatccgccccgaggac
gaggccgcgcacaccgcactgctcggcgcgatgacgcccgacgatctgcgcatgcgcttc
ttcggctcgatccgcagcttcgatcactcgcaggtcgcgcgcatgacgcagatcgactac
gaccgcgagatggcgctgatcgccaccgccgatgatgacgacgggcagcggcagacgctg
ggcgtggtgcgcgcggtggccgatccggacaacgaaaccgccgagttcgcgatcgcgatc
cgtcctgaccagaagggcagcgggctggggcggctgctgatggggcagatcatcgactac
gcgcgctcgcgcggcacgcactggctgatcggcgaggccttgcgcgagaacggcgcgatg
atcggcctggcgcgtgcctcgggcttcgcggtgagcgcgggcgaggagccgggtgtggtc
gcgttccgcttgaagctgcgggattga

DBGET integrated database retrieval system