KEGG   Burkholderia gladioli: bgla_2g29050Help
Entry
bgla_2g29050      CDS       T01464                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bgd  Burkholderia gladioli
Brite
Enzymes [BR:bgd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     bgla_2g29050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:3590074..3591084
Genome map
AA seq 336 aa AA seqDB search
MTDTQRDLVLVTGASGFVGSAVARIAQAKGYAVRVLVRASSPRTNLAELDAEIVTGDMRD
EASMRAALRGVRHLLHVAADYRLWAPDPLEIERANLEGAVATMRAALAEGVERIVYTSSV
ATLKVTGSGASTDETSPLTAEQAIGVYKRSKVLAERAVERMIAEHGLPAVIVNPSTPIGP
RDVKPTPTGRIIVEAATGKIPAFVDTGLNLVHVDDVAQGHFLALEKGRVGERYILGGENL
PLQQMLADIAGMTNRKPPTIALPRGPLYPIAYAAEAIAKFTRREPFVTVDGLKMSKNKMY
FTSAKAERELGYRARPYRDGLRDALDWFREAGYLKR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgacagacacacaacgcgatctcgtactcgtcaccggcgcgtccggcttcgtcggctcc
gccgtcgcgcgcatcgcgcaggccaagggttatgccgtgcgcgtgctggtgcgcgcctcg
agcccgcgcaccaacctcgccgaactcgacgccgagatcgtcaccggcgacatgcgcgac
gaggcctcgatgcgcgccgcgctgcgcggggtgcgccacctgctgcacgtggctgccgac
taccggctgtgggcacccgatccgctcgagatcgagcgcgccaacctggagggcgcggtg
gccaccatgcgcgccgcgctggccgagggcgtcgagcgcatcgtgtataccagcagcgtc
gccacgctcaaggtgaccggctcgggcgcctcgaccgacgaaacctcgccgctcaccgcc
gagcaggcgatcggcgtctacaagcgcagcaaggtgctggccgagcgcgcggtggagcgg
atgatcgccgagcacgggctgccggccgtgatcgtcaacccgtccacgccgatcggcccg
cgcgacgtcaagccgacgccgaccgggcgcatcatcgtcgaggccgccaccggcaagatc
cccgccttcgtcgataccggcctgaacctggtccatgtcgacgacgtcgcccagggccat
ttcctcgcgctggagaaaggccgcgtcggcgagcgctacatcctcggcggcgagaacctt
ccgctgcagcagatgctggccgacatcgccgggatgaccaaccgcaagccgcccaccatc
gcgctgccgcgcgggccgctctacccgatcgcctacgcggccgaggccatcgccaagttc
accaggcgcgaacccttcgtgacggtggacggtctgaagatgtcgaagaacaagatgtac
ttcacgtcggcgaaggccgaacgcgaactcggttaccgcgctcgcccgtatcgcgacggg
ctgcgcgatgcgctcgactggttccgcgaggcaggctacctgaagcgctga

DBGET integrated database retrieval system