KEGG   Burkholderia gladioli: bgla_2p0310Help
Entry
bgla_2p0310       CDS       T01464                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bgd  Burkholderia gladioli
Brite
Enzymes [BR:bgd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     bgla_2p0310
Secretion system [BR:bgd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   bgla_2p0310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
bgla_2p:complement(37737..38630)
Genome map
AA seq 297 aa AA seqDB search
MIKVILSGLLVALLASACALPESQHGSSATAAPSSTPAARTVAPAPSPAAPVDPADPNLD
PGVAALKASLHARYPATQFREVAATPSTGIYEVVMGNKVAYTDVTGRYFLFGHLFDMVTQ
QDLTVPLEQALQKVRFPADRLQDAFVEVHGSGRRKLAIFDDPDCPYCLVLESDLAKLKDV
TIYRFMYPLESIHPRARAHAIAIWCAEDRLGAWRAWMPLALSRWMRDQGASPAAAGGTPA
PSRTEPKLVSCANPIDANEALAASLGIAGTPALVSEDGRVMPGAASAEAIDQWLGAK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggtgatcctatccgggctgctcgtcgcgctgctcgccagtgcgtgcgctctg
cccgagtctcaacacggttcgtcggcgaccgctgcgccgagctcgacgccggccgcgcgc
accgttgcgccggccccctccccggccgcgccggtcgatccggcggatcccaacctcgat
ccgggtgtcgctgcgctcaaggcatcgctgcatgcgcggtatccggcaacccagttccgt
gaggtggccgccaccccgtcgaccggcatctacgaggtcgtgatgggcaacaaggtcgcg
tacaccgacgtgaccggccgctatttcctcttcggccacctgttcgacatggtgacccag
caagacctgaccgtcccgctcgagcaagccctgcaaaaggtacgcttcccagccgaccgg
ctgcaggacgcttttgtcgaggtacatggcagcggccgccgcaagctcgccatcttcgac
gatccggactgcccttactgcctcgtgctggagtccgacctggccaagctcaaggacgtg
acgatctaccggttcatgtacccgctggagtcgattcacccccgcgcgcgtgcgcatgcg
attgccatctggtgcgccgaggaccgcctgggcgcctggcgggcctggatgccgctcgct
ctgtcgcgctggatgcgtgaccaaggtgcgtcgccggcggccgccggcggcaccccagcg
ccgagtcgtaccgagccgaagttggtctcgtgtgcgaacccgatcgacgcgaacgaggcg
ctcgccgcgagcctcggcatcgccggcaccccggcgctggtgagcgaggacgggcgcgtg
atgccgggcgcggccagcgccgaggcgatcgaccaatggctgggagcgaagtaa

DBGET integrated database retrieval system