KEGG   Burkholderia gladioli: bgla_4p1430Help
Entry
bgla_4p1430       CDS       T01464                                 

Definition
JamB protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bgd  Burkholderia gladioli
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bgd01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bgd01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
bgla_4p:complement(128501..129469)
Genome map
AA seq 322 aa AA seqDB search
MSAGKTPLPADDEPTINTVSHGSSSARLDRALALIIVALPAIGTAFAIALWITGQGPGPA
EWAMFGVFYFATALGLEVGFHRHITHKAFNARPWVRSTLIAMGSMGVHGPVNWWAAIHRR
HHATSDGPGDPHSPNLCGASAGGLLKGLYHSHFGWLFVGRSTRPDGWERYVQDLFRDPLV
FRQHMLYYRWVVFGLVVPPLVCGLVAGSWSGVLLGFLWGDLVRIFAVSHCIWALNSFCHV
IGRRDFATTANDRSRNSLLLALPTFGQGWHNNHHAFPGSAFTGLHWWQIDPGGLFVCVLQ
ALRLVSDVNRPSAELIEKKRLC
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaggtaaaacgccgttgccggccgatgacgagcccacgatcaacactgtatcg
cacggctcctcgagcgcgcgcctcgaccgcgcgctcgcactgatcatcgtcgctttgccc
gccatcggcaccgcgttcgcgatcgccctgtggatcacggggcaaggtccgggtccggct
gagtgggccatgttcggcgtgttctacttcgccaccgcactcggcctagaggtcggcttt
caccggcacatcacccacaaggcattcaacgcacggccctgggttcgctctacgctgatc
gcgatgggttcgatgggcgtgcacggcccggtcaactggtgggccgcgatccatcgccgc
catcacgccaccagcgacggccccggcgatccgcattcgccaaacctgtgcggggctagc
gcgggcggcctgctgaaagggctataccacagccacttcggctggctgttcgtcggccgt
tccacgcgccctgacggctgggagcgctacgtccaggacctcttccgagacccgctagtg
ttccggcagcatatgctctactaccgctgggtggtattcggcctcgtcgtgccaccactc
gtatgtggcctcgtcgcgggctcgtggagtggcgtgctgctcggattcctttggggcgat
ctggtgcggattttcgcagtcagccactgcatctgggcgctcaactcgttctgccacgta
attggccggcgagacttcgccaccacggccaacgatcgcagtcgcaacagtttgttgctt
gcgctgcccaccttcggccaaggctggcacaacaaccatcacgcgttccccggctcggca
ttcactggccttcactggtggcagatcgatccgggcggtctgttcgtgtgcgtgctgcaa
gcgctacggctcgtctccgacgtcaatcgcccgtcggccgaactgatcgagaagaaacgc
ctttgctaa

DBGET integrated database retrieval system