KEGG   Burkholderia gladioli: bgla_4p3110Help
Entry
bgla_4p3110       CDS       T01464                                 

Definition
Peptidase M20
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bgd  Burkholderia gladioli
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    bgla_4p3110
  Amino acid metabolism
   00300 Lysine biosynthesis
    bgla_4p3110
Enzymes [BR:bgd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     bgla_4p3110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
bgla_4p:334054..335181
Genome map
AA seq 375 aa AA seqDB search
MSPVIELTRALIAQNTIDPPGNEARAARVIADCLRANGIDPLVYEVAPGRTNLVARIHGN
GKRPSLAFSAHFDTIGVEPEQWSIDPFAGDIRNGRLYGRGSADMKGGMAAMTIAALELHR
GAARLEGDLLLTFSAAENSNCLGARRLLDDGYFAGVGALLISEPTGNRAFITEKGALWLR
ATAHGEYGHNAFSEHRGGDRGNAIVRLARYLDQVHDLRLPAPVHRHVGPPTINIGMIRGG
LSTPLIPAQASADIDVRLVPGQSPESVLAAFRSIAGHHVTIETLDLKLPVDTPDAHPFVL
QCLEACRVEGVRDPGPAGVGYYSDGAVIAPSLDLPMVIIGPGEVGMSGAPDEYVDINNLD
ASVRIFERVARAYLE
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagccccgtcatcgagctaacccgcgcgctcatcgcgcaaaacacgatcgatccgcct
ggcaatgaagcacgagccgcgcgcgtgatcgcggattgcttgcgcgccaacggcatcgac
ccgctcgtctacgaggtggcgccggggcgcaccaacctcgtggcacggattcatggcaac
ggcaaacgcccatcgctggcattctccgcacacttcgacacgatcggggtagagcccgaa
caatggagcattgatcccttcgcgggcgacatccggaatggccgcctctacggccgcggc
tccgccgacatgaagggcggcatggcggcaatgaccatcgcggcgctggagctgcaccga
ggcgccgcgcgactcgagggagatctgctgctgaccttttcggccgccgagaattcgaac
tgcctcggcgcgcggcggctgctcgatgacggttactttgccggcgtcggagcgctgcta
atctcagagccgacgggcaatcgggccttcatcaccgagaaaggcgccctgtggctccgc
gcaacagcgcacggcgaatacgggcacaacgccttctcggagcaccgcggtggcgatcgc
ggcaatgccatcgtgcgcctcgcccgctatctcgaccaggtacacgacctgcgcctgcct
gcgcccgtgcatcgtcatgtcggcccgccaaccatcaacatcggcatgatccgcggcgga
ctgtcgacaccgctgatccccgcccaggcctcggccgacatcgacgtgcggctggtgccg
ggacaatcgcccgaatcggtgctcgcggcgtttcgctccatcgccggccaccacgtcacg
atcgagacgctcgatctcaagcttccagtggacaccccggacgcacatcccttcgtcctg
cagtgcctcgaggcctgccgagtggaaggcgtgcgcgatcccggtcccgccggcgtcggc
tattactcggatggggccgtgatcgcgccttcccttgatttgccaatggtcatcatcggc
ccaggcgaagtcggcatgagcggcgcacctgacgagtacgtcgatatcaacaatctcgac
gcttcggtccgtattttcgagcgcgtggcccgcgcctacctggaatag

DBGET integrated database retrieval system