KEGG   Burkholderia sp. CCGE1002: BC1002_0260Help
Entry
BC1002_0260       CDS       T01217                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00010  Glycolysis / Gluconeogenesis
bge00260  Glycine, serine and threonine metabolism
bge00680  Methane metabolism
bge01100  Metabolic pathways
bge01110  Biosynthesis of secondary metabolites
bge01120  Microbial metabolism in diverse environments
bge01130  Biosynthesis of antibiotics
bge01200  Carbon metabolism
bge01230  Biosynthesis of amino acids
Module
bge_M00002  Glycolysis, core module involving three-carbon compounds
bge_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1002_0260
  Energy metabolism
   00680 Methane metabolism
    BC1002_0260
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BC1002_0260
Enzymes [BR:bge01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BC1002_0260
Membrane trafficking [BR:bge04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BC1002_0260
Exosome [BR:bge04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BC1002_0260
  Exosomal proteins of melanoma cells
   BC1002_0260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADG14367
JGI: BC1002_0260
UniProt: D5WAR4
Position
1:complement(288477..289223)
Genome map
AA seq 248 aa AA seqDB search
MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNLEAQQAGVLLKESGYTFDIAYTSVLKR
AIRTLWHVQDKMDLMYLPVVHSWRLNERHYGALSGLNKAETAAKFGDKQVLVWRRSYDTP
PPALEPTDERAPYTDPRYAKVPREQLPLTECLKDTVARVLPLWNESIAPAIKSGRSILIA
AHGNSIRALVKYLDNISDSDIVGLNIPNGVPLVYELDEDLKPIKHYYLGDQDAIAKAQAA
VASQGKAG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaactcgttctcatccgccacggcgaatcgacgtggaacaaggaaaaccgcttt
accggctgggtcgacgtcgacctcaccgagcagggcaacctcgaggcgcagcaggcgggc
gtgctgctcaaggaatccggatacacgttcgacatcgcctatacgtcggtgctcaagcgc
gcgatccgcacgctgtggcacgtgcaggacaagatggacctgatgtacctgcccgtcgtg
cattcgtggcgcctgaacgagcgccactacggcgcgctgtcgggtctgaacaaggccgaa
acggccgccaaattcggcgacaaacaggtgctggtctggcgccgcagctacgacacgccg
ccgcccgcgctcgagccgaccgacgagcgcgcgccgtacaccgacccgcgctacgccaag
gtgccgcgcgagcaactgccgctgaccgagtgcctgaaagacacggtcgcgcgcgtgctg
ccgctgtggaacgagtcgattgcgccggccatcaagtcgggccgcagcatcctgatcgcc
gcgcacggcaactcgatccgcgcgctggtcaagtacctcgacaacatctcggacagcgac
atcgtcggcctgaacattccgaacggcgtgccgctcgtctatgaactcgacgaagatctg
aagccgatcaagcactactatctcggcgaccaggacgcgatcgcgaaggcacaagccgcg
gtcgcgagccagggcaaggcgggctga

DBGET integrated database retrieval system