KEGG   Burkholderia sp. CCGE1002: BC1002_0260Help
Entry
BC1002_0260       CDS       T01217                                 

Definition
phosphoglycerate mutase (EC:5.4.2.4)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1002_0260
   01230 Biosynthesis of amino acids
    BC1002_0260
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1002_0260
  Energy metabolism
   00680 Methane metabolism
    BC1002_0260
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BC1002_0260
Enzymes [BR:bge01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BC1002_0260
Exosome [BR:bge04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BC1002_0260
  Exosomal proteins of melanoma cells
   BC1002_0260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(288477..289223)
Genome map
AA seq 248 aa AA seqDB search
MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNLEAQQAGVLLKESGYTFDIAYTSVLKR
AIRTLWHVQDKMDLMYLPVVHSWRLNERHYGALSGLNKAETAAKFGDKQVLVWRRSYDTP
PPALEPTDERAPYTDPRYAKVPREQLPLTECLKDTVARVLPLWNESIAPAIKSGRSILIA
AHGNSIRALVKYLDNISDSDIVGLNIPNGVPLVYELDEDLKPIKHYYLGDQDAIAKAQAA
VASQGKAG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaactcgttctcatccgccacggcgaatcgacgtggaacaaggaaaaccgcttt
accggctgggtcgacgtcgacctcaccgagcagggcaacctcgaggcgcagcaggcgggc
gtgctgctcaaggaatccggatacacgttcgacatcgcctatacgtcggtgctcaagcgc
gcgatccgcacgctgtggcacgtgcaggacaagatggacctgatgtacctgcccgtcgtg
cattcgtggcgcctgaacgagcgccactacggcgcgctgtcgggtctgaacaaggccgaa
acggccgccaaattcggcgacaaacaggtgctggtctggcgccgcagctacgacacgccg
ccgcccgcgctcgagccgaccgacgagcgcgcgccgtacaccgacccgcgctacgccaag
gtgccgcgcgagcaactgccgctgaccgagtgcctgaaagacacggtcgcgcgcgtgctg
ccgctgtggaacgagtcgattgcgccggccatcaagtcgggccgcagcatcctgatcgcc
gcgcacggcaactcgatccgcgcgctggtcaagtacctcgacaacatctcggacagcgac
atcgtcggcctgaacattccgaacggcgtgccgctcgtctatgaactcgacgaagatctg
aagccgatcaagcactactatctcggcgaccaggacgcgatcgcgaaggcacaagccgcg
gtcgcgagccagggcaaggcgggctga

DBGET integrated database retrieval system