KEGG   Burkholderia sp. CCGE1002: BC1002_0311Help
Entry
BC1002_0311       CDS       T01217                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00900  Terpenoid backbone biosynthesis
bge01100  Metabolic pathways
bge01110  Biosynthesis of secondary metabolites
bge01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BC1002_0311
Enzymes [BR:bge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BC1002_0311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADG14418
JGI: BC1002_0311
UniProt: D5WB89
Position
1:complement(335043..335924)
Genome map
AA seq 293 aa AA seqDB search
MIETTDSLRDCLAPAKLNLFLHITGRRPDGYHTLQTVFQLLDWGDTLHFTRRDDGLITRR
TEIASVPPEHDLTVRAATLLKSHTGSREGVDIEIDKRLPMGAGLGGGSSDAATTLLALNR
LWKLDLPRQELQELALKLGADVPFFVFGKNAFAEGVGESLDVVQLPPRHFLVVTPRVQVP
TAAIFSEKALTRDTKPLIITDFPAERSCNTEWPESFGRNDMQQVVIGKYAEVAQVLRWFE
NVAPARMSGSGASVFAAFRSKAEAEAAQAKLPGEWNSAVAAGLDQHPLFAFAS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaacaaccgactcgctgcgcgactgtctcgcgccagcgaaactcaatctcttc
ctgcacatcaccggccgtcggccggatggttatcacacgctgcagacggtcttccagttg
ctcgactggggcgacacgctgcacttcacgcgacgcgacgacggtctcatcacgcgccgc
accgaaatcgcctccgtgccacccgagcatgacctgaccgtacgtgccgcgacattgctg
aagtcgcatacgggctctcgcgaaggcgtcgatatcgaaatcgacaagcgcctgccgatg
ggcgcaggcctcggcggcggcagttccgacgcggcgacgacactgctcgcgctcaatcgc
ctgtggaagctcgatctgccgcgtcaggagttgcaggaacttgcgttgaagctcggcgcg
gacgtgcctttctttgtatttggaaaaaatgcgttcgcagagggtgtcggagaatcatta
gacgttgtacaattgccgccgcgtcactttctggtagtgacgccgagggtgcaggttcca
actgcagcgattttttccgaaaaagcgttgacaagagatacaaagcctctcataatcacg
gactttcctgcagaacgcagctgcaacactgagtggccagaaagcttcggccggaatgac
atgcagcaggttgtgataggaaagtacgcggaagtagcgcaagtgttgcggtggtttgag
aacgtcgcaccagcgcggatgtccggatcgggtgccagtgtttttgcagcgttccgtagc
aaagctgaagcagaagcggcgcaagccaaactgcccggcgaatggaatagcgcagtagca
gcgggcttggatcagcatccactctttgctttcgcgtcataa

DBGET integrated database retrieval system