KEGG   Burkholderia sp. CCGE1002: BC1002_0450Help
Entry
BC1002_0450       CDS       T01217                                 

Definition
ATPase AAA
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bge00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BC1002_0450
Enzymes [BR:bge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BC1002_0450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(493238..495511)
Genome map
AA seq 757 aa AA seqDB search
MSEVRLVRVSTIRSDNPKGFGGYIFYGPTIDSCGTVLDAKEHVVVFLSRDLGIVGLQVGQ
WWRVTGKATRRERTINGFLIVEQQVHAESAELALPSGEHLVTFIAESDAFPGVGMVKARK
LWETFGDRLYSILDEGDESTLSTSVSPETAQVLVDGWKFFGNARTISWLSQHGFEVELGK
KVVDYFGAEAPEAISEDPYRLLSFCASWHVTDRLAREHFGVGQDDPRRLRGAIEETLYRL
FGDGHTAATDAMVMTRLASVLGDDATRAPRSLVRSALETGRQHGCFVVADDGMLHPLGAY
VMETTVASALAIRLRTIAPANSRLLSRVRVEELIAEFESDEQISFSAEQRIAVHLAAENR
LCVISGGAGVGKTTILRCIYRVYREASILVIQAALAGRAAKRMESVTGLPARTLAALQRK
VTPEQLSEHCVIVVDEASMVDIITMYRLCSLLPPHVRLLLVGDALQLMPVGPGLVLHALT
SNSRIPQVHLEVPQRFAGEIARAATSVRTGTWPEIPSDLDAPVVFLRRKPALATGRVDSA
WSIAQTVLSLFQLEPKASQILCARKRGKEGVLALNEACQNVLTGSAPCLTIWNSELDALC
NTGFRLGDPVVCTRNLYSAGLQNGSLGTLCKIEPEPKPVIADRGDMLGNAIAWIDWDDGE
CRPVFESLLDHLDLAYALTIHKAQGSQWERVIIPITRHRLLDRTLIYTALTRAQRQVILV
GDEEAARHAVESLPRAGLRNTALGSFLEELLARHVAA
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagtccgccttgtcagggtgtcaactatacgcagtgacaatccgaaaggtttc
ggcgggtacatcttttatggtccgacaatcgattcgtgcggcactgtgctggatgccaag
gagcatgtggtcgtcttcttgtcgcgcgaccttggtatcgtcggtcttcaggtaggccaa
tggtggcgtgtgaccggcaaggcgactcgtcgcgaacgcaccattaacggttttctcatc
gtcgagcagcaggtgcatgccgagagcgctgagcttgcgcttccctctggagagcacctc
gtaacatttatcgcagagagcgatgcattccccggcgtaggcatggtcaaagctcgaaag
ctttgggagacctttggcgaccggctttatagcatcctggatgagggcgacgagtcgacg
ttatccacgagcgtttccccggagaccgctcaagtgttagtggatggttggaagttcttt
ggcaacgctcgcactatatcctggttgtcccagcacggttttgaggtcgaactagggaaa
aaagtcgtcgactacttcggcgcggaggcaccggaagccatatcagaagacccatatcgc
ttgctaagcttttgcgcgagctggcatgtcacggaccggctcgcgcgagaacacttcggg
gttggtcaagatgacccccgccgcctgcgcggcgccatcgaagagaccctttatcgcctc
ttcggggacggccatacagccgcgaccgatgcgatggtgatgacgcgattggcatctgtg
cttggtgatgatgccacacgcgcgccgcgaagtcttgtgcggtcagcattggaaacagga
cggcaacatggatgcttcgttgtcgcggacgacggcatgctccatcctcttggcgcatac
gtgatggaaacaaccgtcgcgtcagcgttggcgattcgtcttcggaccatcgcacccgcc
aattcccgcttgttgagccgcgttagggtcgaagaactcatcgcggaattcgagagcgat
gaacagatttcgtttagcgccgaacagcgtattgccgttcatctggccgcggagaacagg
ctctgtgtcatatccgggggcgccggagtgggcaagacaacgattctgaggtgcatctat
cgggtttatcgtgaggcttctattcttgtcatccaggctgcactcgctggtcgggcggca
aagcggatggagtcagtcaccgggctgcctgcccgcaccctcgcggcgctacagcgaaag
gtcacgcccgagcaactgtcggaacactgcgtgatagtcgttgatgaagcgagcatggtg
gatatcatcaccatgtacagactctgctcgctcctgccgccccacgtccgcctgctgctg
gtcggcgatgcattgcagttgatgcccgtcggtccggggctggtgctacatgcattgacc
agcaactcacgaatcccgcaagtgcatctggaggttccacagcgattcgccggcgagatt
gcgcgggctgccacttccgtgcgaaccggcacatggcctgagattccatcagatttggac
gcaccggtagtgttcctgaggcgcaagcctgcccttgctaccggacgggtggattcggcg
tggtcaattgcgcagaccgtgctaagcctgtttcagctcgagccgaaagcgagtcagata
ctttgtgcgcgcaagagaggcaaagagggtgtgcttgctctgaatgaggcctgtcagaac
gtgctgacggggagcgccccgtgcttgaccatatggaatagcgaactggacgcattgtgc
aacaccggcttccggcttggcgaccctgtggtttgcacgcgaaacctctactctgccggt
ctgcaaaacggctcactgggaacgctgtgcaaaattgagccggagcccaaacctgtgatt
gccgacaggggcgacatgcttggtaacgccatcgcctggattgattgggacgacggcgag
tgccgccctgttttcgaatcgttgctcgaccatctcgaccttgcgtatgcgctgacgatt
cacaaggcgcaaggttcgcagtgggagcgtgtcatcatcccgataacgcgacacaggctt
ctcgaccggactctcatttacacagcgttgacacgcgctcaacgtcaggtaattcttgta
ggcgacgaggaagcagcccggcatgctgtcgagtcgctcccccgcgcgggactgagaaac
accgccctcgggtcattcctcgaagagttgctcgcgcggcatgtcgctgcctga

DBGET integrated database retrieval system