KEGG   Burkholderia sp. CCGE1002: BC1002_0510Help
Entry
BC1002_0510       CDS       T01217                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BC1002_0510
Enzymes [BR:bge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BC1002_0510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(568184..568726)
Genome map
AA seq 180 aa AA seqDB search
MTVAYLGLGANLGDARQTLKDAVVCLAQQHTITVLAKSSLYRTAPIDAGGDDYFNCVVKL
ETTLPVRHLLALCHKIEHQFGRERPFRNAPRTLDLDILLYGDQSIDEADLIVPHPRLVER
AFALVPLVEIDAAIVIPQHGRAAALLDSVSDQRIEKVKGPCQCPMLNALAGNSAEKGRCE
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgcttatcttggcctcggcgcgaatctcggggacgcgcgccagaccctgaaa
gacgcggtggtgtgcctcgcacaacagcacaccatcaccgtgctcgccaaatcgagccta
tatcgcactgccccgatcgacgcgggcggcgacgactatttcaattgcgtcgtgaagctg
gaaacgacgctccccgtgcggcatctgctcgcgctatgtcacaagatcgagcatcagttc
ggccgtgaacggccgttccgaaatgcgccgcgcacgctcgatctcgacatcctgctgtac
ggcgatcaatcgatcgacgaagccgatctgatcgtgccgcatccacgcctcgtcgagcgc
gcgtttgcgctggtgccgctggtcgagatcgacgcggcgatcgtgattccgcaacatggc
cgggccgcggctctgctcgacagcgtcagcgatcagcgcatcgagaaggtgaaggggccc
tgccagtgtccgatgctcaatgcactcgccggtaattccgccgagaaaggccgttgcgaa
tga

DBGET integrated database retrieval system